SecReT6
Protein ID: 374293951
SecReT6 ID526
T6SS typeN/A
Gene symbol-
Locus tagAZOLI_p30483
StrainAzospirillum lipoferum 4B
Repliconplasmid AZO_p3 [GenBank: NC_016623] [Browse all T6SS(s) in this replicon]
Location [Strand]517110..520619 [+]
Productputative Type VI secretion protein IcmF-like
NoteTssM
UniProt IDG7ZEP8
KEGG IDali:AZOLI_p30483
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.70E-84, Aligned region: 188..449
ImcF-related_N [PF14331], Evalue: 6.70E-84, Aligned region: 836..878
IcmF-related [PF06761], Evalue: 6.80E-69, Aligned region: 242..253
IcmF-related [PF06761], Evalue: 6.80E-69, Aligned region: 505..810
DUF1215 [PF06744], Evalue: 4.60E-38, Aligned region: 909..1028
AAA_16 [PF13191], Evalue: 0.00041, Aligned region: 122..254
AAA_16 [PF13191], Evalue: 0.00041, Aligned region: 822..833
AAA_16 [PF13191], Evalue: 0.00041, Aligned region: 915..944
Protein Sequence: 1169 a.a.     [Download]
>gi|374293951|ref|YP_005040974.1| putative Type VI secretion protein IcmF-like [Azospirillum lipoferum 4B]
MSRLTAILLSRAVLGFIGAAIAAALIALLAPLAGLEMPWLAVAAAVPFPILAVVLILLKRRDAKAEERMT
AELTGGSDAARMAAMDQADEVAGLRKTFADSLALLKAGRKQRGLGDGYLYSTPWYVIIGPPGAGKTTALL
KSGLNFPLADQTGAKPLKGVGGTRQCDWWFADEAIFLDTAGRYTTQDSHEAVDQTGWGAFLKLLKDARSR
QPINGVLVAMAVPDLAAAGPEERAQHAAAIRRRLRELYETLKVKAPVYLLLTKADLIAGFNEFFHDLNRD
ERRQIVGVTLPAAESELGDAGMATLGSELDGIAGRLSARAVDRIQQEHAQERRGAIFAFPSQLASLKEPL
LDFVAAAFKANRYEPALRLRGIYFTSGTQEGTQIDRLIGGLAESFGLPAAPFRGGAVAAGQQRSYFLGGL
LNDLVFREANLVGFDPSAERRRIWVPRIAYSLFGLVTVAATAAWVASYLGNAGLIDREQQAVDAYRPKAE
ALAAGTVADDDIRRVLPVLNELRALPAGHDTLALKQKLALDFGLYQGDKLEEAGDALYRRAVNGLLVPRL
LVRVQRDLRDRLVADDAPAVEALLRLYLTLGGAGPVNGEEVKAWTVGWLRRVSPPPGEDETKALLGHIDA
GLGAPAGLPKVNLDGELIRQSREVLARTPLAARAYAAIRDGEAARKLQEWRPTEQAGPEGDRVFRRSSGA
RFSDGIPGFYTQQGFTGVMLPGLPGAARSVRDLSWLLGPPRGEEAGPELETAALTLYLRDYAGRWDALLN
DITLVPAANPQALAEEVNILSGRASPLQKLLAAVANETTLQRVPEAPAGASPAVAAVAAAVADSGVAKLV
TQMVDDRFRPLNDFTRNSGNARLEELLRQLEGVHAVLARLSLGTGSGQKLFDLAANGGGEVFQKLATDMA
YYPQPVRRWTEELVEQGTARTLSGARSQINAEWQSTVLPWCRRSLDNRYPFVKGASADVGMDDFARLFAP
GGLIDAFFANRLRPFVDTTREPWRWQPSAADLGIPSSVLPAFQHAAMIRDAFFPDGGRVPSLRFELRPTL
LGAGVEQVDLDIDGQRMTFARNATLAQGLQWPKPGGAGDLRVTFTGQPTEPPEMTQRTGSWAWFRTLDAN
RGRKGSVPDRIPLSFGAGGKSASFDVRMTSAVNPFSIRDLKDFRCPDGL
 
Nucleotide Sequence: 3510 bp     [Download]
>gi|374293519|ref|NC_016623.1|:517110-520619 Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence
ATGAGTCGGCTGACCGCCATCTTGCTCTCCCGCGCAGTGCTGGGCTTCATCGGTGCGGCGATCGCGGCGG
CGCTGATCGCGCTGCTGGCGCCGCTGGCCGGGCTGGAGATGCCCTGGCTGGCCGTGGCCGCCGCCGTGCC
CTTCCCGATCCTGGCCGTCGTGCTGATCCTGCTGAAGCGCCGCGACGCCAAGGCCGAGGAGCGGATGACG
GCGGAGTTGACCGGCGGCAGCGACGCGGCCCGCATGGCGGCGATGGACCAGGCCGACGAGGTCGCCGGCC
TGCGCAAGACCTTCGCGGACTCGCTGGCCCTCTTGAAGGCCGGGCGCAAGCAGCGGGGGCTGGGCGACGG
CTATCTCTACTCGACCCCCTGGTACGTCATCATCGGCCCGCCCGGTGCCGGCAAGACCACGGCGCTGTTG
AAGAGCGGCCTGAACTTCCCGCTGGCCGACCAGACCGGGGCCAAGCCGCTGAAGGGCGTCGGCGGCACCC
GCCAATGCGACTGGTGGTTCGCCGACGAGGCCATCTTCCTCGACACCGCCGGACGCTACACCACCCAGGA
CAGCCACGAGGCGGTCGACCAGACCGGCTGGGGCGCCTTCCTGAAGCTGTTGAAGGACGCGCGGTCGCGC
CAGCCGATCAACGGCGTGCTGGTGGCGATGGCGGTGCCCGACCTCGCCGCCGCCGGGCCGGAGGAGCGGG
CGCAGCATGCCGCCGCCATCCGCCGCCGCCTGCGCGAGCTGTACGAGACGTTGAAGGTCAAGGCGCCGGT
CTATCTGCTGCTGACCAAGGCCGACCTGATCGCCGGCTTCAACGAGTTCTTCCACGACCTGAACCGCGAC
GAACGCCGGCAGATCGTCGGCGTCACCCTGCCGGCGGCCGAAAGCGAGCTGGGCGATGCCGGCATGGCGA
CGCTGGGCAGCGAGTTGGACGGCATCGCCGGCCGGCTGTCCGCCCGCGCGGTCGACCGCATCCAGCAGGA
GCATGCGCAGGAGCGCCGCGGCGCCATCTTCGCCTTCCCGTCGCAGCTGGCCTCCTTGAAGGAGCCGCTG
CTCGACTTCGTCGCCGCCGCCTTCAAGGCCAACCGCTATGAGCCGGCGCTGCGGCTGCGCGGCATCTATT
TCACCAGCGGCACCCAGGAAGGCACGCAGATCGACCGGCTGATCGGCGGGCTGGCCGAGAGCTTCGGCCT
GCCGGCGGCGCCCTTCCGCGGCGGCGCCGTCGCCGCCGGGCAGCAGCGCAGCTATTTCCTCGGCGGGCTG
CTGAACGATCTGGTGTTCCGCGAGGCCAATCTGGTCGGCTTCGACCCGTCGGCGGAACGGCGGCGCATCT
GGGTTCCGCGCATCGCCTACAGCCTGTTCGGGCTGGTGACGGTCGCCGCCACCGCCGCCTGGGTCGCCAG
CTATCTCGGCAATGCCGGGCTGATCGACCGCGAACAGCAGGCGGTCGACGCCTATCGCCCGAAGGCGGAG
GCGCTGGCCGCCGGTACCGTCGCCGACGACGACATCCGCCGCGTGCTGCCGGTGCTGAACGAGCTGCGCG
CCCTGCCGGCCGGCCATGACACGTTGGCGCTGAAGCAGAAGCTTGCGCTCGATTTCGGGCTCTACCAGGG
CGACAAGCTGGAAGAGGCCGGCGACGCGCTCTACCGCCGCGCGGTCAACGGGCTGCTGGTTCCGCGCCTG
CTGGTGCGGGTGCAGCGCGACCTGCGCGACCGGCTGGTCGCCGACGACGCCCCGGCGGTGGAGGCGCTGC
TGCGGCTCTACCTGACGCTGGGCGGCGCCGGGCCGGTCAATGGCGAGGAGGTGAAGGCCTGGACCGTGGG
CTGGCTGCGCCGCGTCTCGCCCCCGCCGGGCGAGGACGAGACCAAGGCGCTCCTCGGCCACATCGATGCC
GGGCTGGGGGCTCCCGCCGGGCTGCCGAAGGTCAATCTGGATGGCGAGCTGATCCGCCAGTCGCGCGAGG
TGTTGGCCCGCACGCCGCTGGCCGCCCGCGCCTATGCAGCCATCCGCGACGGCGAGGCCGCGCGCAAGCT
GCAGGAATGGCGCCCGACCGAGCAGGCCGGGCCGGAAGGCGACCGGGTGTTCCGCCGCTCCTCCGGCGCG
CGGTTCAGCGACGGCATTCCGGGATTCTACACGCAACAGGGCTTCACCGGCGTGATGCTGCCGGGGCTGC
CCGGTGCGGCGCGGTCGGTGCGCGACCTCAGCTGGCTGCTCGGCCCCCCGCGCGGGGAAGAGGCCGGGCC
GGAGCTTGAGACGGCGGCGCTGACCCTGTATCTGCGCGACTATGCCGGGCGCTGGGACGCTCTGCTGAAC
GACATCACCCTGGTGCCGGCCGCCAACCCGCAGGCGCTGGCCGAAGAGGTCAACATCCTGTCCGGCCGCG
CCTCTCCCCTGCAGAAGCTGCTGGCGGCGGTGGCGAACGAGACGACTCTGCAGCGCGTGCCGGAGGCGCC
GGCCGGCGCCTCTCCGGCGGTGGCCGCCGTGGCCGCGGCGGTCGCCGACAGCGGCGTCGCCAAGCTGGTC
ACCCAGATGGTGGACGACCGGTTCCGCCCGCTGAACGACTTCACCCGCAACAGCGGCAATGCCCGGCTGG
AGGAACTGCTGCGCCAGCTTGAGGGCGTGCATGCGGTGCTGGCGCGGCTGTCGCTGGGTACGGGCAGCGG
GCAGAAGCTGTTCGATCTGGCGGCCAACGGCGGCGGCGAGGTATTCCAGAAGCTCGCCACCGACATGGCC
TATTATCCGCAGCCGGTCCGCCGCTGGACCGAGGAACTGGTGGAGCAGGGCACGGCGCGGACGCTGAGCG
GCGCCCGGTCGCAGATCAACGCCGAATGGCAGAGCACGGTGCTGCCCTGGTGCCGCCGCTCGCTCGACAA
CCGCTATCCCTTCGTCAAGGGCGCCTCGGCCGATGTCGGCATGGATGACTTCGCCCGGCTGTTCGCGCCC
GGCGGGTTGATCGACGCCTTCTTCGCCAACCGGCTGCGCCCCTTCGTCGACACCACGCGGGAGCCGTGGC
GCTGGCAGCCGTCGGCCGCCGACCTCGGCATTCCGTCGTCGGTGCTGCCGGCCTTCCAGCATGCGGCGAT
GATCCGCGACGCCTTCTTCCCCGATGGCGGCCGGGTGCCCTCGCTGCGCTTCGAGCTGCGCCCGACCCTT
CTCGGCGCCGGGGTGGAGCAGGTGGATCTGGACATCGACGGCCAGCGCATGACCTTCGCCCGCAACGCCA
CGCTGGCGCAGGGGCTGCAATGGCCGAAGCCGGGCGGGGCGGGCGACCTGCGCGTCACCTTCACCGGCCA
GCCGACCGAACCGCCGGAGATGACCCAGCGCACCGGCAGCTGGGCGTGGTTCCGCACGCTGGACGCCAAC
CGCGGCCGCAAGGGATCGGTGCCCGACCGCATCCCGCTCAGCTTCGGCGCCGGCGGCAAGTCGGCCAGCT
TCGACGTGCGGATGACCAGCGCGGTCAACCCCTTCTCGATCCGCGACCTCAAGGACTTCCGATGCCCGGA
CGGTCTGTGA
 Primer design