SecReT6
Protein ID: 374300585
SecReT6 ID531
T6SS typei1
Gene symbol-
Locus tagDesaf_2238
StrainDesulfovibrio africanus str. Walvis Bay
Repliconchromosome [GenBank: NC_016629] [Browse all T6SS(s) in this replicon]
Location [Strand]2479097..2482579 [+]
Producthypothetical protein
NoteTssM
UniProt IDF3YWS2
KEGG IDdaf:Desaf_2238
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.50E-49, Aligned region: 183..433
ImcF-related_N [PF14331], Evalue: 1.50E-49, Aligned region: 830..881
DUF1215 [PF06744], Evalue: 0.00016, Aligned region: 529..560
DUF1215 [PF06744], Evalue: 0.00016, Aligned region: 955..1006
Protein Sequence: 1160 a.a.     [Download]
>gi|374300585|ref|YP_005052224.1| hypothetical protein [Desulfovibrio africanus str. Walvis Bay]
MKRFLFVALMALLALILLAAALVGLYVLGQRLGWPWWTGPVILCGLFGLILGALLLKRWLIRRREEEFVK
RIIEQDEATIAAAPAKERPQLRDLQERWRQAIEILRTSRIRQHGNPLYVLPWYLVMGEAGSGKTTAIKSA
RLATPLTDVGPAQGISGTRNCDWWFCEDAIILDTAGRYAIPVDEEHDKEEWRKFLSLLVKYRKREPLNGL
VVTIAADKLLDAGLDKLVEEGRSIRARVDELMRAIGARIPVYVLVTKTDKILGLAELAETLPDKALEGAM
GQVVPLPGLEIGEALEGALDAISEQLRALRCRIVLCREGSPSGLLLLPGEIDALRSGLLTFARALFAENP
YQETPLCRGLYFSSARQEGIARSQLLQGLSTLDQGGQQLRAGEKGLFLRGLFARVLPSDRGLFTPLAAFL
RRRRLSEGLGLLAWNLVMLSLCGLLTASFLKNKTALEDFTEDFSLVPRLSGDIEQDLLLMDRFRIELVRM
GERDRDWWLPRMGLTQSLQVEKDLKLRFCALLEEGALGQWDRQFQDMLARVSTSDSDAVVAKLAEHLVRR
AKLIDAKLKGAGHAQLAAMPQPTYELLQVFSPEALSEEAFLVSGLALAWLEWTPDQASLIQSRTKAREQL
TAIAAKSNVSLHWLVSWANETGLDGQPITLEQFWGLGSLHGHDNAGLPPAFTRQGKARIDAFLKEIQASL
ERPQGLEPRRVEFERWYEDQYLLAWESFVGKAAQARHQITDADRRKDLAGGMASMSSPYFTLLDVMAEEL
GFLKGKAGLPGWVELAWRLREAKLLAQRQEADKSAPVVVRTVREGEQGLEQALGKGSGSDIKRIEAVRAA
SKELEAYAAALEQILPVATSPAVAYAVAADFYPYSTVQHESKSPFYAAANSISKLKSILGTRGAAEQPFW
DLASGPLQYLLDYTSQEAACELQTRWEEEVLSQIQSVPESKLGKTLFEPSAGLVWKFLKGSAAPFLGQNR
RGHFAKVALGSSLPVSGEFLAFLSRTKTQEQMRLPSYPLTINAQPLDVNSDAQEEPSAGILNIQCANATH
RLENYNYPVSMSLDWAPDVCGDVSLDIKFSSFTLTKKYAGVRGVPMFLADFRTGVRRFTPNDFPDSKASL
EDLGVREITVKYQLEGSVPILKLQAVKPLKVPEVIAQCWR
 
Nucleotide Sequence: 3483 bp     [Download]
>gi|374298386|ref|NC_016629.1|:2479097-2482579 Desulfovibrio africanus str. Walvis Bay chromosome, complete genome
ATGAAACGGTTCCTCTTCGTGGCACTCATGGCCCTGCTGGCGCTCATCCTGCTGGCTGCCGCGCTTGTCG
GCCTCTACGTGCTCGGCCAGCGTCTCGGCTGGCCGTGGTGGACCGGCCCGGTCATCCTGTGCGGCCTCTT
CGGGCTGATCCTGGGCGCCCTGCTCCTCAAGCGCTGGCTTATCCGCCGGCGGGAGGAGGAGTTCGTCAAG
CGCATCATCGAACAGGACGAGGCAACCATTGCCGCTGCCCCGGCCAAGGAGCGACCGCAGCTTCGGGACC
TCCAGGAACGCTGGCGCCAAGCCATCGAGATTTTACGCACCTCACGCATCAGGCAACACGGCAATCCGCT
CTACGTCCTGCCCTGGTACCTGGTCATGGGCGAGGCCGGATCGGGCAAGACGACCGCCATCAAAAGCGCC
CGCCTAGCCACGCCCCTGACGGACGTCGGCCCGGCCCAGGGCATATCAGGCACGCGCAACTGCGACTGGT
GGTTCTGCGAGGACGCCATCATCCTCGATACGGCCGGCCGCTACGCTATCCCCGTGGACGAGGAGCATGA
CAAGGAGGAGTGGCGCAAGTTCCTCTCCCTGCTCGTCAAGTACCGCAAGCGAGAGCCCTTGAACGGGCTG
GTCGTAACCATTGCCGCGGACAAGTTGCTCGATGCCGGCCTGGACAAGCTCGTCGAGGAGGGCAGGAGCA
TACGGGCCCGCGTGGACGAGCTGATGCGGGCCATTGGCGCGCGTATTCCCGTGTATGTCCTGGTGACCAA
GACCGACAAAATTCTCGGCTTGGCCGAGTTGGCCGAAACGCTGCCGGACAAGGCTCTGGAAGGAGCCATG
GGGCAGGTTGTGCCTCTTCCTGGCCTGGAGATAGGTGAGGCCCTGGAAGGGGCCCTTGACGCGATCAGCG
AGCAGCTGCGCGCGCTGCGTTGCCGCATAGTGCTCTGCCGGGAGGGATCTCCCTCCGGGCTGCTGCTCCT
GCCAGGAGAGATCGACGCCCTGCGTTCCGGGTTGCTCACCTTTGCCAGGGCCCTGTTCGCCGAGAATCCG
TACCAGGAGACCCCGCTGTGCAGGGGACTTTACTTTTCCAGCGCACGGCAGGAGGGCATCGCGCGCTCGC
AGCTCCTGCAGGGACTTTCGACCCTTGACCAGGGGGGGCAGCAGCTGCGGGCTGGCGAGAAGGGGCTCTT
CCTGCGCGGACTGTTCGCCAGGGTGCTGCCCTCGGATCGGGGCTTGTTCACCCCGCTGGCCGCATTCCTG
CGTCGGCGAAGGCTGTCGGAAGGTTTGGGGCTGCTGGCCTGGAACCTCGTCATGCTCTCCCTTTGCGGCC
TGCTGACCGCCTCCTTCCTTAAGAACAAGACGGCCCTGGAGGATTTCACCGAGGACTTCTCCCTGGTGCC
GAGACTGTCTGGCGATATAGAGCAGGATCTGCTGCTCATGGACCGCTTCCGCATAGAACTCGTGCGCATG
GGCGAGCGGGACAGGGACTGGTGGTTGCCCCGGATGGGGTTGACCCAAAGCCTTCAGGTGGAGAAGGACC
TCAAGCTGCGCTTCTGCGCGCTGCTCGAGGAAGGCGCACTGGGGCAATGGGACAGGCAATTCCAGGATAT
GCTGGCCCGGGTTTCCACCTCGGACTCGGATGCCGTGGTGGCCAAGCTCGCCGAGCATCTGGTCCGGCGC
GCAAAGCTTATCGACGCAAAGCTAAAGGGCGCTGGCCATGCGCAGCTCGCCGCAATGCCCCAGCCGACCT
ATGAGCTGCTGCAAGTCTTCTCGCCCGAAGCCCTGTCGGAGGAGGCGTTCCTGGTCTCCGGGCTCGCCCT
GGCCTGGCTGGAGTGGACCCCGGACCAAGCCAGCCTGATCCAGAGCCGGACAAAGGCCCGGGAACAACTG
ACGGCCATCGCCGCCAAGTCCAACGTAAGCCTGCATTGGCTCGTCAGCTGGGCAAATGAAACGGGCCTGG
ATGGCCAGCCGATCACCCTGGAGCAGTTCTGGGGCCTCGGCAGCCTGCATGGCCATGACAATGCCGGCCT
GCCTCCGGCCTTTACCCGCCAGGGCAAGGCCCGCATCGATGCATTCCTCAAGGAGATCCAGGCCTCCCTG
GAAAGGCCCCAGGGCCTGGAGCCGCGCCGGGTGGAATTCGAGCGCTGGTACGAAGACCAGTACCTCCTGG
CCTGGGAGAGCTTCGTCGGCAAGGCCGCGCAGGCTCGGCACCAGATTACCGATGCGGACCGCCGCAAGGA
TCTGGCCGGCGGGATGGCCTCCATGTCTAGTCCCTATTTCACCTTGTTGGACGTCATGGCCGAGGAACTT
GGATTCCTCAAGGGCAAGGCCGGCCTGCCGGGCTGGGTGGAGCTTGCCTGGCGCCTGCGCGAAGCCAAGC
TCCTGGCGCAGCGGCAGGAAGCGGACAAGTCCGCGCCGGTGGTCGTAAGGACCGTCAGGGAAGGGGAGCA
GGGCCTTGAGCAGGCCTTGGGCAAGGGCTCGGGATCGGACATCAAACGGATTGAGGCTGTGCGCGCCGCC
TCCAAGGAACTCGAGGCCTATGCCGCAGCGCTCGAGCAGATTTTGCCGGTCGCGACTTCTCCGGCCGTGG
CCTATGCCGTGGCAGCGGACTTTTATCCCTACAGCACGGTGCAGCATGAAAGCAAATCGCCGTTCTACGC
TGCCGCCAATTCGATCTCCAAGCTAAAGTCCATCCTCGGCACGCGCGGTGCAGCGGAACAGCCCTTCTGG
GATCTGGCTTCAGGTCCTCTGCAGTACCTTCTTGACTACACCTCCCAGGAGGCGGCCTGCGAGCTGCAGA
CGCGCTGGGAGGAGGAGGTGCTGAGCCAGATCCAGAGCGTGCCCGAATCCAAACTCGGCAAGACCTTGTT
CGAGCCATCGGCGGGGCTGGTCTGGAAGTTCCTCAAGGGCTCAGCCGCGCCCTTCCTCGGCCAGAACAGG
CGGGGGCACTTCGCCAAGGTCGCCTTGGGCAGCAGCCTGCCCGTGAGCGGGGAGTTCCTTGCCTTCCTGA
GCAGGACCAAAACCCAAGAGCAGATGCGCCTGCCGAGCTACCCCCTGACCATCAACGCTCAGCCGCTCGA
CGTGAACAGTGACGCGCAGGAGGAGCCCTCGGCCGGCATCCTTAACATCCAGTGCGCCAACGCCACGCAC
AGGCTGGAGAATTACAATTACCCCGTAAGCATGAGCCTGGACTGGGCGCCCGATGTGTGCGGAGACGTCA
GCCTCGATATCAAGTTCAGCAGCTTCACGCTGACCAAGAAATACGCCGGCGTCAGGGGCGTGCCCATGTT
CCTGGCGGACTTCAGGACGGGCGTCAGGCGCTTCACCCCTAACGACTTCCCGGACAGCAAGGCCAGCCTC
GAGGACCTGGGGGTGCGCGAAATCACGGTGAAGTACCAGCTTGAGGGCAGTGTCCCGATCCTGAAGCTGC
AAGCCGTCAAGCCGCTCAAAGTGCCGGAAGTCATAGCCCAATGCTGGCGGTAG
 Primer design