SecReT6
Protein ID: 374311786
SecReT6 ID532
T6SS typei4b
Gene symbol-
Locus tagAciX8_2883
StrainGranulicella mallensis MP5ACTX8
Repliconchromosome [GenBank: NC_016631] [Browse all T6SS(s) in this replicon]
Location [Strand]3555500..3558760 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDG8NPU7
KEGG IDgma:AciX8_2883
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.40E-49, Aligned region: 6..61
IcmF-related [PF06761], Evalue: 3.40E-49, Aligned region: 438..740
ImcF-related_N [PF14331], Evalue: 2.30E-33, Aligned region: 118..389
DUF1215 [PF06744], Evalue: 7.50E-13, Aligned region: 870..942
Protein Sequence: 1086 a.a.     [Download]
>gi|374311786|ref|YP_005058216.1| ImcF domain-containing protein [Granulicella mallensis MP5ACTX8]
MRNKTANTSMLDALLREAENKLGSAGRKGKTLHTLPMLYLLGDTNAAKTTAVLRTDWNAELIAGEAMRDG
EVCPTSTLNLWFADGVLLAETGAALNDSPAQRRRLFAKTRPGSWRTSFRGDAPLRAAVVCVSCERLLGAN
AASELAALAAKTGEQLRELAKFLGTAVPVYVLFTKADRIPFFAAWVRNLSTDEASLLLGAAPRDFSVRPG
STWAETASATILQSYDGLLSDLQGTRLPLLARETDGPVAAENYEFPREMRKLRNSLSAFLIELVRPSQLH
ASPLLRGFYFTGVRAHMVEQIISEAAATPKAIAQQDAGATRIFSALSAQQGAASADSFAPRTSSKKTAQW
TFLPRFFPQAVLRDAAALAGSGTTRQASLFQRFVYGTAAALLLLLLIAFTVSYSNNHTIEKQLNAADQQL
AHNEAVGGANELAAMSQLEQLDILRSHLVQLEQWQREGAPLGYRWGLYHGNTLLAPARRLYFEHFRALLL
TRTQNNLIAELGGLPATPPQNADYNSTYEALRGYLITTSYPQYSTSAFLAPVLTNHWQNGATISSEHRAL
AQRQFAFYADELTLNNPYSIRPVDTSVNQARTYLAGFGGFERIYQSILTAASRQTASIDFNAQFPHSAET
ILEPHIVLGAFTPSGYTFMQNALAHPEVYFRGEAWVLGDKAPATIDTGSLKQQLTTRYDTDYITTWRAFL
DQAHVVKARSLAEAGTKLGIVSGTNSPLLALIQTASYNTSVQDKSISDAFQAPQTLVPPANKDQYLTASN
KNYVDGLLTLRSSIQQVTASPSGALGPAAAAPIASAASAAHLAAQQTAQAFHIDAQAHTDAVTLALMEAP
ITSADALLRGLGPAEANAGSRSFCSVVNGLFSKFPFNPASSVQATPAEVTAVLQPNSGELWQFYNTNLKS
LLVQQGTHYSEAPNPPIRVNPAFLRFFNRAADLSAAFFPAGATAPSLTFTLHNLPSNGVQKATLKVDSQT
LALKDPPKQFTWQAANAANASLTANDLPLTFTGVWAVFEMLDKGKIERSITPNTYDLSFALELANTPVRA
PDGTPIVVDYELSGPGASVLAPGSMSGLRCVDSVAR
 
Nucleotide Sequence: 3261 bp     [Download]
>gi|374308961|ref|NC_016631.1|:3555500-3558760 Granulicella mallensis MP5ACTX8 chromosome, complete genome
ATGCGAAACAAAACAGCAAATACGAGCATGCTGGATGCGCTACTGCGCGAAGCCGAAAACAAGCTTGGTT
CCGCGGGCCGCAAGGGCAAGACACTACACACACTGCCCATGTTGTACCTGTTGGGCGACACCAATGCCGC
CAAGACAACAGCCGTCCTGCGCACCGACTGGAATGCGGAATTGATCGCCGGCGAAGCAATGCGTGATGGC
GAAGTCTGCCCGACCTCCACCCTGAACCTTTGGTTTGCCGATGGCGTACTCCTCGCCGAAACAGGCGCCG
CGCTCAACGACTCCCCTGCGCAGAGGCGTCGACTCTTCGCCAAAACGCGCCCCGGTTCATGGCGAACCTC
TTTTCGCGGAGACGCTCCTCTGCGCGCTGCCGTGGTCTGCGTAAGCTGTGAGCGCCTGCTTGGGGCCAAT
GCAGCCTCAGAGCTTGCGGCACTGGCCGCAAAGACAGGTGAGCAACTACGCGAGCTCGCAAAATTTCTAG
GGACCGCTGTGCCGGTCTATGTACTCTTCACGAAAGCGGATCGCATCCCCTTCTTCGCCGCTTGGGTACG
CAACCTGTCGACTGACGAGGCAAGCCTGTTGCTGGGTGCCGCGCCACGAGATTTTTCTGTACGTCCGGGC
AGCACATGGGCAGAAACAGCTTCAGCCACCATCCTGCAAAGCTATGATGGGCTACTATCTGATCTCCAGG
GAACAAGGCTTCCGCTGCTGGCGCGTGAGACCGACGGCCCCGTCGCTGCGGAAAACTATGAGTTCCCTCG
TGAGATGCGCAAGCTGCGTAACTCACTCTCAGCATTTTTGATCGAGTTAGTTCGCCCCAGTCAGCTTCAT
GCGAGCCCTCTATTGCGAGGCTTTTATTTCACCGGCGTTCGCGCGCACATGGTGGAACAAATCATCTCAG
AGGCGGCAGCAACTCCAAAAGCAATAGCCCAACAGGATGCCGGCGCCACCCGAATATTTTCGGCCTTATC
TGCACAACAAGGCGCAGCATCTGCGGATTCTTTTGCTCCGCGTACATCCTCAAAGAAGACGGCTCAGTGG
ACCTTCCTGCCGCGTTTCTTTCCTCAGGCAGTGCTTCGCGACGCGGCGGCGCTCGCCGGAAGTGGCACGA
CACGGCAGGCTTCTCTGTTTCAGCGCTTTGTATACGGGACAGCTGCAGCTCTCTTATTGTTGCTCCTGAT
AGCATTCACGGTCTCTTACTCGAACAACCATACGATCGAGAAGCAACTGAACGCCGCAGACCAGCAACTC
GCGCACAACGAAGCTGTAGGAGGAGCAAACGAGCTCGCGGCCATGTCTCAGCTCGAACAACTCGATATTC
TGCGCTCTCACCTGGTACAGCTTGAGCAATGGCAGCGCGAAGGCGCGCCCCTGGGATATCGCTGGGGCCT
CTATCACGGCAATACGTTGCTTGCGCCAGCACGCCGGCTGTACTTCGAGCACTTCCGCGCACTGCTACTC
ACGCGAACCCAGAATAACCTTATCGCAGAGCTCGGCGGACTGCCGGCCACGCCGCCACAAAATGCCGACT
ACAACAGCACCTACGAGGCCCTGCGCGGGTACCTCATTACAACGTCTTACCCGCAGTACAGCACCTCAGC
CTTTCTGGCTCCTGTATTAACCAACCACTGGCAGAATGGCGCGACCATATCGTCCGAACACCGCGCTCTG
GCACAGCGTCAATTCGCATTCTATGCGGATGAACTCACGCTGAACAATCCTTATTCGATAAGACCGGTCG
ACACCTCCGTAAATCAGGCGCGCACTTACCTCGCAGGCTTCGGTGGCTTCGAACGTATCTACCAGAGCAT
CCTGACTGCGGCCAGCAGGCAAACTGCCTCCATTGATTTCAATGCACAGTTCCCCCACTCTGCGGAGACG
ATTCTGGAACCACATATCGTCTTAGGAGCATTTACTCCATCCGGTTATACCTTTATGCAAAACGCTCTTG
CTCACCCCGAGGTCTACTTCCGTGGCGAAGCCTGGGTACTCGGCGACAAGGCTCCGGCAACCATCGACAC
CGGTTCACTCAAACAGCAATTAACCACAAGATATGACACGGACTATATAACGACGTGGCGAGCCTTTTTG
GACCAGGCCCATGTAGTAAAGGCCCGCAGCCTGGCGGAAGCGGGAACGAAGCTGGGCATCGTCTCCGGAA
CAAACTCGCCGCTTCTGGCACTTATCCAAACAGCCTCCTACAACACTTCTGTGCAGGATAAGTCCATCTC
CGATGCTTTCCAGGCACCGCAGACACTCGTACCTCCGGCAAACAAGGACCAGTACCTTACAGCCAGCAAT
AAAAATTACGTGGACGGTCTATTAACTCTGCGCAGCAGCATTCAACAGGTAACAGCATCGCCTAGCGGCG
CGCTCGGTCCTGCCGCAGCCGCCCCGATCGCCTCCGCAGCCTCTGCCGCGCATCTTGCCGCACAACAAAC
GGCGCAGGCCTTCCATATCGATGCGCAGGCACACACGGATGCAGTAACACTCGCGCTGATGGAGGCTCCG
ATCACCTCCGCCGATGCGCTTCTACGTGGCCTCGGACCGGCAGAAGCCAACGCAGGCAGCAGAAGTTTCT
GTTCTGTCGTCAATGGCCTGTTCTCGAAGTTCCCATTCAACCCTGCAAGCTCTGTGCAGGCCACGCCCGC
CGAGGTGACAGCCGTGCTGCAACCAAACTCGGGTGAGCTATGGCAGTTCTACAACACGAATCTGAAATCG
TTGCTGGTACAACAGGGTACCCACTATAGCGAAGCACCGAACCCACCCATACGGGTGAACCCTGCATTCC
TGCGCTTCTTCAACCGTGCCGCGGATCTTTCAGCCGCATTCTTCCCTGCGGGCGCCACCGCACCTTCACT
CACCTTCACGCTGCATAACCTCCCGAGTAACGGAGTGCAGAAGGCTACTTTGAAGGTAGATTCGCAGACG
CTTGCCTTGAAAGATCCGCCCAAGCAGTTCACCTGGCAGGCAGCCAATGCAGCCAATGCCAGCCTTACGG
CGAACGATCTTCCACTTACTTTTACTGGGGTATGGGCAGTCTTTGAGATGCTCGACAAAGGAAAGATCGA
ACGCAGTATCACGCCAAACACTTACGATCTAAGTTTTGCTTTGGAGCTTGCCAATACTCCGGTGCGTGCG
CCAGACGGAACGCCCATCGTAGTGGACTATGAGCTCTCGGGACCCGGGGCTTCGGTACTCGCCCCGGGAT
CGATGAGTGGCCTACGCTGCGTAGATAGCGTGGCAAGATAA
 Primer design