SecReT6
Protein ID: 374330203
SecReT6 ID533
T6SS typei1
Gene symbolicmF
Locus tagPSE_1855
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]1956757..1960158 [-]
ProductType VI secretion protein IcmF
NoteTssM
UniProt IDG8PFZ7
KEGG IDpsf:PSE_1855
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-74, Aligned region: 151..407
IcmF-related [PF06761], Evalue: 2.10E-72, Aligned region: 463..772
DUF1215 [PF06744], Evalue: 1.00E-28, Aligned region: 666..714
DUF1215 [PF06744], Evalue: 1.00E-28, Aligned region: 877..987
Protein Sequence: 1133 a.a.     [Download]
>gi|374330203|ref|YP_005080387.1| Type VI secretion protein IcmF [Pseudovibrio sp. FO-BEG1]
MAILSVIWGVSNLVYVSIKKKKVDLSKNKDKKEKPKTPDLSYLNEFERGFTQALQTISRNWAGKGERKKG
KNLYALPWFVVLGSPSSGKTSLIVESNLKFPLAHLFSQEDAKHVQPTKDVDCWVTDEAVLFDVAGQFVEH
VNGQQPDSKETYYSGLWRRFLKLLRDNRPRRPINGVVLCLDLSELLSLSSQERTTKAALVHARLSEMTEV
LGTRYTVHVVLTKFDLIDGFHEFIGCLAAAERAKPFGFTFDLHDGRDQDKWLDEFNSAFAKFLDDLNNTV
VDRLSEMRSAHQRRQLYLFTREMAGLSNILSSFLGKALHQDKFSTAPHIRGVFFSSARQEAIPTNPVLLA
TSQKYEIAAPILPIHSGPSKQYFSASLFDQVVFKEAGLAGDNIKIERAKRFALVGSGLAASLLYVGFFST
YWVGYENNRARADEVVDITESFEELFQQGPDKNLNASGQNYIRPLGALTSASDIFGNYRDRNWLISQLSL
YQGYKIGPEVEKAYVDMLARYFLPEVAAYVRNEIAALGNDETSKDSNERLEALRVYLMLGDASRRNELLV
KSWMEQKWQEQFEGDLKLQKALLDHLVFAIETAGLEAKLDKDLVETSQRDLREVPRDLRLYRNIEQVSDR
QLASPVNFRNDIGPAYNIVFSGTGTTAHDDQPIGVKQFFTKDAYLDYFVKMNDGLSVVAVEDAWVADERD
TVEYSQADLKEFRRKIASRYATNYISNWNDALNRLEITDFRNLDHAVDILETLTGPDRPLNRLINRVKSE
TEIYESKLIELNAEQAVNSDLPFDIYREQGLRVRRAFSNLNGLVEAEEGEKAYLEDLDAALNTLYEYLKD
IRQAGERSGEVALARAKARIDLQGEDPIYTLKRIGVDLPSPLNRFFAKLADQSWKVLLQEAKKELQRSWN
EEIYADYNLNYAQLYPFNKQAEQEIPLEEFESFFGPGGKIETFYKKNLIVFVDEATGEPKTIDGRHLAIA
KEFQDNLKIILDLRRSYFNSEGLIGVEYNIQPISLSAKLRRAVMNIEGQIISYSHGPRRPIRVIWPNVLT
NEAESSLSVFPAGRGRPHTTTFKGPWSGFRLLDFATTKGFDSNGALIEFSFNGQKATYSLLHKGASSLAR
KQPLSGLILPAKM
 
Nucleotide Sequence: 3402 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c1960158-1956757 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGGCCATACTTTCTGTCATTTGGGGCGTGAGTAACTTAGTTTATGTAAGCATAAAGAAGAAAAAGGTTG
ATTTAAGTAAAAATAAAGACAAAAAAGAAAAGCCAAAGACACCTGATCTATCCTATCTGAATGAGTTTGA
ACGCGGCTTCACACAGGCACTCCAAACAATCAGCAGAAATTGGGCAGGCAAGGGTGAACGGAAGAAAGGA
AAGAACCTCTACGCACTTCCCTGGTTCGTCGTATTGGGCTCTCCCAGTTCAGGTAAGACATCCCTGATCG
TTGAATCGAATTTAAAGTTCCCGCTCGCCCACCTATTCTCTCAGGAAGATGCAAAACACGTCCAACCAAC
CAAGGACGTCGATTGCTGGGTAACTGATGAAGCTGTTCTCTTTGATGTCGCAGGCCAGTTCGTTGAGCAT
GTAAACGGCCAGCAACCAGACTCTAAAGAAACGTATTACTCCGGTTTATGGCGTCGTTTCCTAAAGCTTT
TGCGGGATAACCGGCCACGCAGACCGATCAATGGCGTCGTATTGTGTCTGGATCTCTCAGAACTGCTTTC
ACTCAGCTCGCAAGAACGAACAACGAAAGCAGCCCTTGTTCACGCTCGCCTGAGCGAAATGACGGAAGTG
CTCGGCACTCGCTACACCGTACATGTCGTGCTGACAAAGTTCGATCTGATCGATGGTTTCCATGAGTTCA
TTGGATGTCTGGCTGCAGCCGAAAGAGCAAAACCGTTCGGCTTTACATTTGATCTTCACGATGGCCGTGA
TCAAGATAAGTGGTTGGACGAGTTCAATTCAGCCTTTGCCAAGTTTCTTGATGACCTCAACAACACCGTT
GTCGACCGACTTTCTGAAATGCGGTCGGCGCATCAAAGGCGCCAGCTATACTTGTTCACGCGCGAAATGG
CTGGTCTGAGCAATATACTGAGCTCTTTTCTGGGGAAAGCCCTCCATCAGGACAAGTTTTCAACTGCTCC
TCATATCCGCGGTGTCTTCTTTTCCTCTGCACGTCAGGAGGCCATTCCCACAAATCCGGTTTTACTGGCA
ACTTCGCAGAAGTATGAGATCGCAGCACCTATCCTGCCCATTCATAGCGGTCCATCCAAACAGTACTTCT
CTGCTTCACTCTTTGATCAGGTCGTGTTCAAGGAAGCCGGCCTTGCGGGCGATAACATCAAGATCGAGCG
CGCCAAACGCTTCGCTCTCGTCGGATCAGGCCTTGCCGCTTCTCTTCTTTATGTTGGCTTTTTCAGCACC
TATTGGGTCGGCTATGAAAACAATCGGGCACGAGCTGACGAGGTCGTCGATATAACCGAGAGCTTCGAAG
AGCTGTTTCAGCAAGGTCCTGATAAGAATCTTAACGCCTCTGGACAGAACTACATCCGTCCTCTTGGCGC
ACTCACATCTGCAAGCGACATCTTTGGCAACTATCGCGACAGAAACTGGCTTATCTCCCAACTCTCACTT
TATCAGGGCTATAAGATCGGCCCGGAAGTTGAAAAAGCCTACGTCGATATGCTGGCCCGCTACTTCCTCC
CAGAGGTTGCAGCATATGTCCGAAACGAGATCGCAGCTCTTGGGAATGATGAAACCAGCAAAGACAGTAA
TGAACGTCTGGAAGCGTTGCGTGTCTACCTTATGCTGGGCGACGCTTCCCGGCGAAATGAGCTCCTCGTA
AAATCCTGGATGGAACAGAAATGGCAGGAGCAGTTTGAAGGCGATCTCAAACTACAAAAAGCGCTGCTCG
ATCATCTTGTCTTTGCCATCGAAACCGCCGGGCTAGAAGCGAAGCTGGACAAAGATCTGGTTGAGACCTC
TCAAAGAGATCTGAGAGAAGTGCCACGAGATCTGCGCCTCTACCGCAACATCGAGCAAGTCAGTGACAGA
CAGCTGGCCTCTCCGGTGAACTTCAGAAACGACATCGGGCCGGCATACAACATCGTTTTCAGCGGAACCG
GCACCACCGCTCATGATGATCAACCAATTGGGGTAAAGCAGTTTTTCACAAAAGATGCTTATCTCGACTA
TTTCGTCAAAATGAATGATGGCCTGTCCGTCGTCGCCGTAGAGGATGCCTGGGTGGCCGACGAGCGGGAC
ACCGTGGAATATTCCCAAGCTGACCTAAAAGAGTTCCGTCGCAAAATCGCATCCCGCTATGCAACGAACT
ACATCTCCAACTGGAATGACGCGCTGAACCGTTTGGAAATTACGGACTTCAGAAATCTAGACCACGCCGT
AGATATTCTGGAAACACTAACTGGCCCAGACAGGCCTCTTAATCGGCTCATCAACCGGGTTAAGAGTGAA
ACAGAAATCTACGAGAGTAAGCTCATTGAGCTCAATGCCGAGCAAGCCGTCAATTCTGATTTGCCCTTTG
ACATCTATAGAGAACAAGGCCTCCGCGTTCGCCGCGCCTTTTCCAACCTCAATGGATTGGTGGAAGCTGA
AGAAGGTGAGAAGGCTTATCTGGAAGATCTAGATGCGGCCCTTAATACTCTTTACGAATATCTGAAAGAC
ATCCGCCAAGCCGGGGAACGATCTGGCGAAGTTGCATTGGCACGTGCCAAAGCCAGAATTGATCTTCAGG
GCGAAGACCCAATCTATACACTCAAACGCATAGGCGTCGACCTTCCCAGCCCACTCAATCGCTTTTTCGC
AAAACTGGCAGATCAAAGTTGGAAGGTGTTGCTGCAAGAAGCCAAGAAAGAGCTGCAACGCAGTTGGAAC
GAGGAAATCTATGCGGACTATAACCTTAACTACGCACAGCTTTATCCTTTCAACAAGCAGGCTGAGCAAG
AGATCCCACTTGAAGAATTTGAAAGCTTCTTCGGCCCGGGCGGCAAGATCGAAACGTTCTACAAAAAGAA
CCTGATCGTGTTTGTTGATGAGGCAACGGGCGAGCCTAAAACCATCGATGGTCGCCATCTCGCCATCGCT
AAGGAATTTCAGGATAATCTCAAGATCATCTTAGATCTGCGCAGAAGCTACTTCAACTCAGAAGGACTGA
TCGGTGTGGAGTACAACATCCAGCCTATCTCTCTTTCCGCAAAACTCCGCCGCGCCGTGATGAATATTGA
GGGACAAATCATTTCCTACTCCCATGGTCCACGTCGCCCTATCCGAGTGATCTGGCCGAATGTTCTCACA
AATGAAGCTGAGAGCAGCCTATCAGTCTTCCCTGCGGGTCGTGGTCGCCCACACACCACCACCTTTAAGG
GGCCGTGGTCAGGCTTCCGACTGCTGGATTTTGCCACGACTAAAGGCTTTGATAGCAATGGCGCACTGAT
CGAGTTCAGCTTCAACGGGCAGAAAGCAACATACTCCTTGCTTCATAAAGGAGCCAGTTCACTGGCACGC
AAACAGCCACTCTCCGGCCTTATCCTGCCAGCAAAGATGTGA
 Primer design