SecReT6
Protein ID: 374331190
SecReT6 ID534
T6SS typei3
Gene symbolicmF
Locus tagPSE_2844
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3035230..3038859 [-]
ProductType VI secretion protein IcmF
NoteTssM
UniProt IDG8PRZ6
KEGG IDpsf:PSE_2844
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.50E-88, Aligned region: 510..817
ImcF-related_N [PF14331], Evalue: 4.30E-87, Aligned region: 198..457
DUF1215 [PF06744], Evalue: 2.30E-33, Aligned region: 820..854
DUF1215 [PF06744], Evalue: 2.30E-33, Aligned region: 944..1067
CopD [PF05425], Evalue: 0.0021, Aligned region: 3..78
DUF3366 [PF11846], Evalue: 0.0068, Aligned region: 8..77
DUF3366 [PF11846], Evalue: 0.0068, Aligned region: 418..484
DUF3366 [PF11846], Evalue: 0.0068, Aligned region: 578..607
Protein Sequence: 1209 a.a.     [Download]
>gi|374331190|ref|YP_005081374.1| Type VI secretion protein IcmF [Pseudovibrio sp. FO-BEG1]
MSRLKRFFPFWFVTLLITLILCAVVWIYGPSLSIFGAKPFAMAVVRMLVVMGLLMIWAAINIARLSRRAR
EAEAKNEEEEEEEEPEVDPDELAKNEAALVTTKVEKSLNILKTASVDGKLGRRVIYQLPWYLMIGPEESG
KTTALLRSGMKFPLAHKLGQKVDAATVEPTAECEYWFSNNAIIVDSAGRYTMQDQDEIIDASGWNTLLTL
IKKNRRRQPLNGMIIAINLAKLVTLRSDQRLDMARTVKQRVKEAEKQLGLRFPIYVMFTKLDLIAGFTDY
FQILGRDERHQVWGMTFPVDDGKSSENAISHFDEEYELLMEQLNSRVYDYLNKETDIQHRSLIFSFPQQM
ASLQTVLNDFLTEMFRPNRYEDRSFLRGVYFTSATQEGQPVDLLAGSIAQAYGVGRQALPSAPYERHSYF
LERLFFDLIFGEGNLAGESKQVMRKQKIRKRLSLAACFIALAFLTTVWVISYELNQENIINRANADLKEF
PKFADRIDAVRVNDANYLAVLPLLNYLRDLPGGYSDQQEKPPQNERWGLNQIPIVAEDADALYHNGLERY
LRPRMMLRLEQQMVANIDNPEFLFEALRIYLELADKGPIEPEIIQRWEETDWQTLYSDPRQVTEREQLSN
HLAALLQQPFKVRIDVNTQLVSQVREILNAQPIAELAYSFIKAGQAAQNLPEWRPDEAGGSATTRVFTRS
SGKPLTEGIPGLYTYDGFHGVFLPQLVDSIQSFVRESWVLGPNGQLENKEETVTRIERGVLGLYLDDYAR
MWDAMLADLRIVKFGSLAQATDVINTASGPNSPIRNMLVSVAEQTQLTRTEAPSSATGIAQNVAGGAARI
AEEEARATTNLRQQQLVEVLGQAVPTREGGPRTAPPGSSVQSRFEALDNYTLGSGSGTTPLDALLMQVTD
LYRELNRILLANNSQQDALSYILGGGSDAVKTLKDEAPNLPMPLQSWIQEMLQFSSQVTSNDAQKAINAA
WDSEVLPLCSSALTNRYPVTDGQQAAVMLDDFSTLFKPGGKIEAFFNTNIKSFVDTSSTPWKWRDGENAR
IGVSKDSLQVFEKANDIRNAYFANGGDKPSVAFTMTPLDLDIGSTRVALTVDGTTVSYAHGPSRPIELSW
PGDGVPSASLAFFPEIAGEANSINLSGPWSLFRLLEKARVTKTDIPDQYKVRFSLGNRFATFNLIANSVN
NPFSARLLQNFTCPKELNT
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3038859-3035230 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGAGTAGACTCAAACGCTTTTTCCCCTTCTGGTTCGTTACACTCCTCATCACACTGATCCTGTGTGCGG
TTGTCTGGATCTATGGTCCAAGCCTTTCCATATTTGGTGCCAAACCATTTGCGATGGCTGTGGTGCGTAT
GCTGGTCGTGATGGGCCTGCTCATGATTTGGGCGGCTATCAACATTGCACGCTTATCTCGCCGCGCGCGG
GAAGCTGAGGCGAAAAACGAAGAGGAAGAAGAGGAAGAAGAGCCTGAGGTCGACCCAGACGAGCTAGCAA
AGAACGAGGCTGCTCTTGTAACCACCAAGGTGGAAAAGAGCCTGAACATTCTTAAAACAGCCAGTGTTGA
CGGAAAGCTCGGGCGCCGCGTTATCTACCAGCTTCCGTGGTATCTGATGATTGGTCCGGAAGAATCCGGC
AAGACCACTGCCCTACTCCGGTCAGGCATGAAGTTTCCATTGGCTCACAAGCTGGGTCAGAAAGTGGATG
CTGCGACCGTGGAGCCGACGGCGGAGTGTGAGTACTGGTTCAGCAATAACGCAATTATCGTGGACAGTGC
TGGTCGTTACACGATGCAGGATCAGGACGAGATCATTGATGCGTCCGGCTGGAACACGCTTCTCACTTTG
ATCAAGAAAAATCGTCGTCGCCAGCCGCTCAACGGCATGATCATTGCGATCAATCTGGCAAAACTGGTTA
CGTTGAGGTCTGACCAGCGCCTTGATATGGCCCGGACAGTCAAGCAACGCGTCAAAGAAGCTGAGAAACA
GCTGGGGCTTAGATTTCCGATCTATGTGATGTTCACCAAACTGGATCTGATCGCTGGTTTTACGGATTAC
TTCCAGATCCTTGGTCGTGATGAACGGCATCAGGTTTGGGGTATGACCTTCCCTGTTGATGACGGGAAAT
CCTCAGAGAATGCGATCAGTCACTTTGACGAGGAATACGAGCTGCTGATGGAGCAGCTCAACTCGCGTGT
ATACGACTACCTCAATAAAGAAACCGACATTCAACACAGAAGTCTGATCTTCAGCTTCCCGCAGCAAATG
GCATCTTTGCAGACGGTGCTGAACGATTTTCTTACTGAGATGTTCCGGCCCAATCGTTATGAAGATCGTA
GCTTCCTGCGTGGTGTTTACTTCACCTCAGCAACTCAAGAAGGGCAGCCTGTCGATCTGTTGGCGGGTTC
TATTGCGCAGGCTTATGGGGTTGGCCGGCAAGCCCTTCCCTCAGCGCCATATGAGCGGCATTCCTATTTC
CTCGAGCGTTTGTTCTTTGACCTGATTTTTGGTGAGGGCAACCTTGCAGGCGAAAGCAAGCAAGTAATGC
GCAAGCAAAAGATCAGGAAACGTCTTTCACTGGCCGCTTGCTTTATAGCTCTGGCATTCCTAACAACCGT
CTGGGTCATCAGCTATGAGCTTAATCAGGAAAACATCATCAATCGCGCGAATGCGGACCTGAAAGAGTTT
CCAAAATTTGCAGATCGTATTGATGCGGTGCGTGTGAATGATGCGAACTATCTGGCTGTGTTGCCGCTGC
TAAACTATCTTCGTGATCTGCCCGGAGGGTACTCTGATCAGCAGGAGAAACCACCGCAGAATGAGCGTTG
GGGTCTTAACCAGATTCCGATTGTCGCTGAGGATGCTGACGCGCTTTATCACAACGGGCTAGAACGCTAT
CTCCGTCCCCGTATGATGTTGCGTCTTGAGCAGCAAATGGTTGCGAACATCGACAATCCTGAGTTTCTGT
TCGAGGCTTTGCGCATCTATCTCGAGCTTGCTGATAAAGGACCGATTGAACCTGAAATCATTCAGCGTTG
GGAAGAAACAGACTGGCAAACGCTCTACAGTGATCCACGTCAGGTCACGGAACGCGAACAGCTCTCCAAT
CACCTTGCCGCTTTGCTTCAACAACCTTTCAAGGTTCGAATTGATGTGAATACACAGTTGGTTAGCCAGG
TTCGGGAAATCCTGAATGCGCAGCCAATTGCAGAGCTCGCCTACTCCTTTATCAAGGCCGGACAAGCTGC
ACAGAACCTACCTGAATGGCGTCCTGATGAAGCTGGCGGTTCTGCCACAACACGCGTCTTTACCCGCTCC
TCAGGGAAACCGTTAACCGAAGGAATCCCTGGACTTTACACCTATGATGGTTTCCACGGTGTCTTCCTGC
CTCAACTGGTGGACAGCATTCAGAGCTTCGTTCGAGAAAGCTGGGTGCTGGGTCCCAACGGGCAGCTTGA
GAATAAGGAAGAGACGGTTACCCGTATCGAACGCGGTGTCCTTGGGCTTTATCTGGATGACTATGCACGT
ATGTGGGATGCGATGTTGGCAGACCTGCGGATCGTGAAATTCGGAAGTCTCGCACAAGCCACTGACGTCA
TTAACACCGCATCCGGTCCAAACTCGCCAATCCGTAACATGCTTGTTTCTGTTGCAGAACAAACCCAGCT
AACCCGCACTGAAGCCCCTTCCAGCGCCACTGGCATTGCTCAGAACGTGGCTGGTGGTGCTGCACGGATT
GCAGAGGAAGAAGCCCGCGCAACAACCAATCTGAGACAGCAGCAGCTGGTTGAAGTTCTTGGTCAAGCTG
TCCCGACCCGTGAAGGTGGTCCAAGAACTGCACCTCCTGGGTCATCCGTTCAGTCCAGGTTTGAGGCCCT
TGATAACTATACATTGGGCAGCGGCAGTGGCACGACGCCCTTAGATGCGTTGTTGATGCAAGTCACTGAT
CTTTATCGTGAACTGAACCGAATTCTACTTGCCAACAATAGTCAGCAGGATGCGCTTAGCTACATATTGG
GTGGCGGTAGTGATGCGGTTAAGACGCTTAAGGACGAGGCTCCAAACCTGCCGATGCCATTGCAGAGCTG
GATACAGGAGATGCTTCAGTTTTCATCTCAGGTGACGTCTAATGATGCACAAAAAGCAATCAATGCTGCA
TGGGATTCTGAAGTTTTGCCGCTTTGCAGTTCAGCTCTGACAAATCGGTATCCGGTGACAGATGGTCAAC
AAGCTGCTGTCATGCTGGATGATTTTTCGACCCTATTTAAACCCGGCGGTAAGATTGAAGCGTTTTTCAA
TACCAACATCAAATCCTTCGTCGATACCTCCAGTACGCCTTGGAAATGGAGAGATGGTGAGAATGCGCGG
ATTGGCGTCTCCAAAGACAGCCTTCAAGTCTTCGAAAAAGCTAACGATATTCGCAACGCATATTTCGCAA
ATGGGGGGGATAAACCATCTGTTGCATTCACGATGACCCCACTGGATCTGGATATCGGATCTACCCGTGT
TGCGCTCACCGTGGATGGGACAACAGTAAGCTATGCACATGGTCCGTCTCGCCCCATTGAACTGAGTTGG
CCCGGCGATGGCGTCCCTTCTGCTAGCTTGGCATTTTTTCCTGAGATTGCCGGAGAAGCAAACTCCATCA
ACCTCAGCGGACCTTGGTCCCTCTTTAGATTATTGGAAAAGGCACGCGTAACGAAGACCGATATACCTGA
TCAATACAAGGTGAGATTTTCGCTTGGAAATCGTTTTGCCACCTTCAATCTCATCGCGAACAGCGTGAAC
AATCCATTCTCCGCAAGGCTACTTCAGAATTTTACCTGCCCCAAGGAGCTCAACACCTAG
 Primer design