SecReT6
Protein ID: 375132905
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00780
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]808587..811997 [-]
Producthypothetical protein
NoteTssM
UniProt IDF0LYJ4
KEGG IDvfu:vfu_B00780
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-41, Aligned region: 169..420
ImcF-related_N [PF14331], Evalue: 2.20E-41, Aligned region: 844..860
IcmF-related [PF06761], Evalue: 1.30E-38, Aligned region: 204..224
IcmF-related [PF06761], Evalue: 1.30E-38, Aligned region: 472..766
DUF1215 [PF06744], Evalue: 2.80E-16, Aligned region: 274..298
DUF1215 [PF06744], Evalue: 2.80E-16, Aligned region: 875..974
DUF1469 [PF07332], Evalue: 0.004, Aligned region: 12..58
DUF1469 [PF07332], Evalue: 0.004, Aligned region: 415..429
Protein Sequence: 1136 a.a.     [Download]
>gi|375132905|ref|YP_005049313.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MMDKKKAILFSTLAACLVGLVTSVVLWLTGTYWLTPWWAVALQVMVMVLILALVGWGVYAYLRRPKVDET
LKQHDEWRKRVLKNRFALIWKKHSKVTSNPYHVPWYVHVSADVSSDVRWLQQMGFESVESIEPVPDDLIA
VRFWVSDSAVLISVDMSFPLATRQASLDVVCELVMKKRDRQAFNGVLCTVDLDHLLQKNEMAVSEFSQQY
RTLLSDLNQRTGLSLPTYCVLTNMAAVRDFCELFSTLDEAAREQPFGVLRPVDEGKGYDKAWFDESFDDL
MRRLAVTASESLKQQLHADYRAASVAGIFQLLALRYDIEDFLSLTFSQHAFDEVALHFRGFFFVNVGGEG
ASTDILTYMHASDLGFESLAGTQQHASSPSLFGKNLFRSCIVKEAPLVGVYRQREWRYRASRVAVFGGLL
LLFGGFLWMLKASFDYQQALDNQALIKLNQYKENLKQDTMVADDLSSPVFSLSELRDINNLYDKQHRPWY
VSDWLPDSSIRRFVHQTYYEELSSVLLTLMRDYILKDLFVYNSLDDKVKMLELLNYHQILYSKHRDDVDS
LVNYYLTSLKEEGEGDVALLERFTALAEDLLRSGATPPDAEPELLALVRKSLSANDISELLYQHILQHPD
FSRRVDMRTKLNPSYQHVFVFKPGFTGYLIPYLFTREGFEDLYNETGFQLASEAIKSYEGVMGNISGDAE
MNRINRQLRERYIGDYVRYWQALMANVSWVDVSGWGEVSKQIEMTVDPVYSPLSQFYHLVAVHTNLSQKK
EGESAPKESREAKEQQVEAGEPNVTAISNTSERVRASIAAPFKAMHQLVAVNEAGQSRLSIALSQLQQTS
DWIAKSKETQDRGSYFLAQLQNTDSNNPLSQLNALAADYNDPVLPMLMRGVARTTNRLAQSAMKAVINHD
WSVLYGGYVRHFAGRYPFDKQAEFDASLADFADFFQSGGQFDQFAQKYAAYLDLTHGRQTQLKGFIVNQT
LPLSDAYQPFSDAVKRMQSGLFIDGRVGVEFLLRAEKMSPDLTGFTLESGSKLFEYRNGPLLWQALSWPI
PANQTQDIAIITKDDKGAETREKLSGEWSWFRVADKMQSAAVVGSDDVAWRYQSANNEVSLQIKSKSAAQ
PFAPRFFDGLTIPIEL
 
Nucleotide Sequence: 3411 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c811997-808587 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGATGGATAAGAAAAAAGCCATTCTCTTTTCAACGCTGGCGGCATGCCTGGTTGGCCTTGTGACGAGTG
TGGTGTTGTGGCTGACCGGAACTTACTGGTTGACGCCGTGGTGGGCGGTGGCGCTGCAAGTAATGGTGAT
GGTGCTGATTCTGGCGCTGGTGGGGTGGGGCGTGTACGCCTATTTGCGTCGTCCGAAAGTGGATGAAACC
CTCAAGCAGCACGACGAGTGGCGCAAGCGCGTGCTCAAAAACCGCTTTGCGTTGATTTGGAAAAAGCACA
GCAAGGTGACTTCTAACCCGTATCATGTGCCTTGGTATGTGCATGTGTCGGCGGATGTGAGTTCTGACGT
TCGCTGGTTGCAGCAAATGGGGTTTGAAAGTGTCGAATCCATCGAACCCGTACCAGATGATTTGATTGCG
GTGCGCTTTTGGGTGTCCGACAGTGCGGTGCTGATCTCCGTTGATATGAGTTTTCCGCTCGCCACACGCC
AAGCCAGTTTGGATGTGGTGTGTGAACTGGTGATGAAAAAACGCGACCGTCAGGCGTTTAACGGCGTGCT
GTGCACGGTGGACCTCGACCACCTGTTGCAGAAAAACGAAATGGCGGTCAGTGAGTTCAGCCAACAGTAT
CGAACGCTGCTGAGTGATTTAAACCAACGCACCGGATTGTCGCTACCCACCTACTGCGTGTTGACCAATA
TGGCCGCAGTGCGTGATTTTTGTGAGTTGTTCTCGACCTTGGATGAAGCCGCACGCGAGCAACCTTTTGG
CGTGTTGCGTCCGGTTGACGAAGGCAAAGGGTATGACAAAGCGTGGTTTGATGAATCGTTTGACGACCTG
ATGCGACGCTTGGCGGTCACCGCCAGCGAATCGCTCAAGCAGCAATTACATGCCGATTATCGCGCCGCAT
CGGTGGCGGGCATTTTCCAACTGTTGGCGCTGCGCTACGACATTGAAGATTTCTTGTCACTCACCTTCAG
CCAGCATGCGTTTGATGAAGTTGCGTTGCATTTTCGTGGTTTCTTCTTCGTTAACGTTGGCGGAGAAGGG
GCATCCACTGACATTTTGACCTACATGCATGCCTCCGATCTTGGCTTTGAATCGCTGGCCGGAACGCAGC
AACATGCCTCCAGCCCGAGCCTATTTGGCAAGAATCTGTTTCGCAGTTGTATTGTCAAAGAAGCGCCTTT
GGTGGGGGTATACCGCCAACGTGAATGGCGTTACCGCGCTTCGCGAGTTGCGGTTTTCGGTGGCTTATTG
CTGCTGTTTGGTGGCTTTTTGTGGATGTTAAAGGCGAGTTTCGACTATCAGCAGGCCTTGGACAATCAAG
CGCTGATCAAACTCAACCAATACAAAGAGAACCTGAAGCAAGACACAATGGTTGCCGATGATCTCTCATC
GCCGGTATTCAGCTTGTCGGAGCTGCGAGACATCAACAATCTGTACGACAAACAGCATCGTCCTTGGTAT
GTCAGTGACTGGCTGCCAGATTCCAGTATCAGACGTTTTGTGCATCAGACCTATTATGAAGAACTGAGCA
GCGTACTGCTGACGCTGATGCGCGACTACATCCTCAAAGATCTGTTTGTCTACAACTCACTGGATGACAA
AGTGAAAATGCTGGAGCTGCTGAACTATCATCAGATCCTCTACAGCAAGCATCGCGATGATGTCGATTCA
CTGGTCAATTACTACCTGACCTCGCTCAAAGAGGAAGGGGAAGGCGATGTCGCACTGCTTGAACGCTTCA
CGGCATTGGCTGAAGATTTGCTGCGCAGCGGGGCCACGCCGCCAGACGCCGAACCGGAGCTACTGGCGCT
GGTGCGCAAATCGTTGTCGGCCAACGACATCAGTGAATTGCTTTATCAGCACATTTTGCAACACCCGGAT
TTTTCACGCCGTGTCGATATGCGCACCAAGCTGAATCCGTCTTATCAGCACGTGTTCGTGTTCAAACCGG
GTTTTACCGGCTATTTGATTCCGTACCTGTTTACCCGCGAAGGCTTTGAGGATTTGTACAACGAAACCGG
CTTTCAGCTGGCGTCAGAGGCGATCAAATCTTACGAGGGCGTGATGGGCAATATCAGCGGTGACGCTGAA
ATGAACCGCATCAACCGTCAGTTGCGTGAACGCTATATCGGTGATTATGTCCGATATTGGCAAGCGTTAA
TGGCCAACGTCAGTTGGGTGGACGTGTCGGGATGGGGCGAGGTCAGCAAGCAGATTGAGATGACGGTCGA
TCCGGTCTACTCGCCACTCAGCCAGTTCTACCATCTGGTCGCGGTGCATACCAATCTGAGCCAGAAGAAA
GAAGGTGAATCTGCGCCCAAAGAGAGCCGTGAAGCCAAAGAGCAACAGGTGGAGGCGGGCGAGCCGAATG
TGACTGCGATCAGCAATACCAGCGAACGGGTGCGAGCCTCAATTGCTGCGCCGTTCAAGGCGATGCATCA
ACTGGTGGCGGTGAACGAAGCGGGACAAAGCCGACTGAGCATTGCGCTTTCGCAACTGCAACAGACCAGT
GATTGGATTGCGAAATCCAAAGAAACACAGGATCGCGGCAGCTACTTCTTGGCGCAGTTGCAAAACACCG
ATTCGAATAACCCGTTGTCACAGCTCAATGCCTTGGCGGCGGATTACAATGATCCCGTTCTGCCGATGTT
GATGCGCGGCGTGGCACGAACGACCAACCGATTGGCACAAAGTGCGATGAAAGCGGTGATCAACCACGAC
TGGAGTGTGTTGTACGGCGGTTATGTGCGTCACTTTGCCGGCCGTTATCCGTTCGATAAGCAGGCGGAGT
TTGATGCCTCGTTGGCCGATTTTGCTGATTTCTTTCAATCCGGAGGTCAGTTTGATCAGTTCGCGCAGAA
ATACGCTGCCTACTTGGACCTGACACATGGGCGTCAAACGCAGCTCAAAGGCTTTATCGTCAATCAGACA
TTGCCACTGTCCGATGCATATCAACCATTCAGTGATGCGGTCAAACGCATGCAAAGTGGCCTGTTTATTG
ATGGCCGTGTCGGCGTCGAGTTTTTACTGCGGGCGGAAAAGATGTCGCCGGACTTGACTGGATTTACGCT
CGAATCAGGCAGCAAACTGTTTGAATACCGCAATGGACCGTTATTGTGGCAAGCGCTCAGTTGGCCGATT
CCGGCGAACCAAACGCAGGACATCGCCATCATCACCAAAGATGACAAAGGGGCAGAAACTCGCGAGAAGC
TGAGCGGTGAATGGAGCTGGTTCCGCGTTGCGGACAAGATGCAGAGCGCCGCCGTGGTGGGCAGTGATGA
TGTGGCTTGGCGCTATCAGTCAGCCAACAACGAAGTCAGCCTGCAAATTAAGTCGAAAAGTGCGGCCCAG
CCGTTTGCCCCGCGTTTCTTTGACGGCCTGACCATTCCAATCGAACTATGA
 Primer design