SecReT6
Protein ID: 375133289
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01189
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1248492..1252037 [+]
ProductIcmF-like protein
NoteTssM
UniProt IDF0LZM8
KEGG IDvfu:vfu_B01189
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.60E-93, Aligned region: 509..824
ImcF-related_N [PF14331], Evalue: 1.40E-80, Aligned region: 69..129
ImcF-related_N [PF14331], Evalue: 1.40E-80, Aligned region: 199..460
DUF1215 [PF06744], Evalue: 2.90E-37, Aligned region: 646..660
DUF1215 [PF06744], Evalue: 2.90E-37, Aligned region: 849..879
DUF1215 [PF06744], Evalue: 2.90E-37, Aligned region: 918..1039
Protein Sequence: 1181 a.a.     [Download]
>gi|375133289|ref|YP_005049697.1| IcmF-like protein [Vibrio furnissii NCTC 11218]
MWKFIVGIVRKLKPGMVAALPILLFTTFILLNVAIWWAGPWLEVSGHKPLESVGARAVASSLFTLGAFAV
WGFWQWRKLQGYQAQQKRDEQLRQDPIQLFEERQEVELNQVMVNMKQNLNKRNYLYALPWYLVLGLENAG
KTSLINRSGQKFVFSSVMRASGQKSENPYSFDWWIGDESVLIDPDGELLTQGNRSEDNDGAMERRLWLHF
VNWLDRTRSRRPLNGIVLALDVSHLATATASERKAYASLLRARLRELMETLSTRLPVYIALTKLDLLYGF
EPFFKHYTKSQREEVLGFTFSLDSIDNLDHWLEEFAKEYAEFVERIHGVLPHAVSAPMSLDERNAIYSFT
RQISGLKEILTQFFQDALASDQFSTSALVRGAYFTSVYQQGVPTNAFDDAASRRYGLSHAVNTAQRAKNS
TIYFTQKLFSNIIYPEAGLASDNFRIARQKRRLIALSFLTCSIATVLLAGTWHRNYLANIKHSDAVLAKV
NQYNDQYPSNVYLASQKDVLEPLNKIREATLEFGFFREKPRFISDFGLYQGHTIGPMVEATYLNLLESRF
LPLLMADVVVDLNQAQTDEEKLAVLRVYRMMVDKSGRYKDYVMDYFAKYWQQEFSGRREIQEELLGHLDY
AMRHTDLAGERARGDKVANQVMKPYDNTIANVQRDLGSMPNDQRVYRNLKLNAQTVLGPAINLRNLVGPV
FDVVFEERVMNSSTLYIPQMLTKRGFEDYFMPQSESVSELALIDSWVLGQSKSAQFSEADKQALRDKIRN
LYVADYTNTWRAALNEIDMKYFSDINDAVTVLDNLTGNIEPLQRLLRTLDDNTKMFAALPKDDSAQKELL
KSPKYKVASMIEAPFSDLNNMIKPVGDKPAYLHEVLASVEELKNYLKSIQDAPDVGMAALDATKARVKLV
NADPIYTLKRIASGLPKPLDTMVAKLADESWYVVKQEAIKHLEVRWHEDVYKTFEEKLAGRYPFNAASKK
DASLEDFEAFFAPNGTLDSFYNNQLRMFIEENITVNNDDTSQSIIRKDVLSQIKQAQKIREAFFNRKGIL
DVSFSVEPLRLSGNKRRSVLNVDGQYLAYSHGPRDSVELIWPNTLRDSAVSKVTLVPTQTNMSPRSINIQ
GPWAFFRLLDQGDVVAASTTSVDYKFAVDGGDMIYRINAEADANPFTERLFRSFKLSKTLY
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1248492-1252037 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGTGGAAATTTATTGTTGGAATAGTGAGAAAGCTCAAGCCGGGAATGGTGGCTGCTTTGCCGATTTTGC
TATTCACCACGTTCATTTTACTGAACGTCGCAATTTGGTGGGCGGGCCCTTGGCTAGAGGTTTCCGGTCA
CAAGCCGCTCGAGTCTGTGGGGGCTCGTGCGGTCGCAAGCAGCCTGTTTACTCTGGGCGCATTCGCCGTT
TGGGGCTTTTGGCAATGGCGTAAACTGCAAGGCTATCAAGCGCAGCAGAAACGTGATGAGCAACTGCGCC
AAGACCCGATTCAGTTATTCGAGGAACGTCAGGAAGTCGAACTGAATCAGGTCATGGTCAACATGAAACA
GAACCTCAATAAGCGCAATTATTTGTATGCGCTACCGTGGTATCTGGTGTTGGGGCTAGAAAATGCGGGT
AAAACCAGCCTGATTAACCGTTCCGGCCAGAAATTTGTGTTCTCGTCGGTGATGCGTGCTTCAGGACAGA
AAAGCGAAAATCCGTATTCGTTTGATTGGTGGATTGGCGATGAATCGGTGTTGATTGACCCGGATGGTGA
GCTGCTGACACAGGGCAATCGCAGTGAAGACAACGACGGAGCGATGGAGCGCCGTTTGTGGCTGCATTTT
GTCAATTGGCTGGACAGAACTCGCAGTCGCCGCCCGCTGAACGGTATTGTATTGGCGTTGGATGTGTCGC
ACTTGGCTACGGCAACGGCATCGGAGCGTAAAGCCTACGCTAGCCTGCTGCGCGCTCGTCTGCGTGAGCT
GATGGAAACTCTTTCAACGCGTTTGCCGGTGTACATTGCACTGACCAAACTTGATCTTCTGTATGGCTTT
GAACCGTTTTTCAAACACTACACCAAGAGCCAGCGTGAAGAAGTGCTGGGCTTCACCTTCTCACTGGATT
CAATTGATAACTTGGATCACTGGTTGGAAGAGTTTGCCAAAGAATACGCCGAGTTTGTCGAGCGGATTCA
TGGGGTCTTACCCCATGCGGTTTCGGCGCCAATGTCGCTGGATGAACGCAATGCCATCTACAGTTTCACG
CGCCAGATCTCCGGTTTGAAAGAAATCCTGACGCAATTTTTCCAAGATGCTTTGGCGAGTGATCAGTTCT
CCACTTCCGCACTGGTACGTGGGGCTTACTTTACTTCGGTGTATCAGCAAGGTGTGCCGACCAATGCGTT
CGATGATGCGGCGTCGCGCCGTTACGGTTTATCGCATGCGGTCAATACTGCTCAGCGCGCGAAAAACTCA
ACCATCTATTTCACCCAGAAGCTGTTCAGTAACATCATTTATCCGGAAGCTGGACTGGCGTCGGATAACT
TTCGAATTGCGCGCCAAAAGCGCCGCTTGATTGCGTTGTCGTTTCTCACTTGTTCGATTGCGACTGTGCT
GCTGGCCGGGACTTGGCATCGTAACTACTTGGCCAACATCAAGCATTCCGATGCGGTGCTGGCGAAGGTG
AATCAGTACAACGATCAATACCCGTCCAATGTGTATCTGGCATCGCAAAAAGATGTGCTGGAGCCGCTGA
ACAAAATTCGTGAAGCCACGTTAGAGTTTGGTTTCTTCCGTGAAAAACCGCGCTTTATTTCTGATTTTGG
CCTGTATCAGGGCCATACCATCGGGCCGATGGTGGAAGCGACGTATTTGAACCTGCTGGAAAGCCGTTTT
CTGCCGCTGCTGATGGCGGATGTGGTGGTTGACCTGAATCAGGCGCAAACGGATGAAGAAAAACTGGCGG
TGCTGCGCGTGTATCGCATGATGGTAGATAAAAGCGGTCGCTACAAAGATTACGTGATGGATTACTTTGC
CAAATATTGGCAGCAGGAGTTCTCAGGTCGCCGTGAAATTCAGGAAGAACTGTTGGGTCACCTCGATTAC
GCCATGCGTCATACCGATTTAGCGGGTGAGCGTGCGCGCGGCGATAAAGTCGCCAATCAGGTGATGAAGC
CGTATGACAATACCATCGCGAATGTGCAACGTGATTTGGGGTCAATGCCAAACGATCAACGTGTTTACCG
TAACCTGAAGCTGAATGCGCAAACGGTGCTTGGCCCGGCGATCAACCTGCGTAATCTGGTGGGGCCGGTA
TTTGACGTGGTGTTTGAAGAGCGCGTGATGAACAGCAGCACGCTGTACATTCCGCAAATGCTCACCAAGC
GCGGCTTTGAAGATTACTTTATGCCGCAGTCTGAATCGGTGTCGGAACTGGCATTGATCGACAGTTGGGT
TTTAGGGCAGTCGAAGTCGGCGCAGTTCAGTGAAGCGGACAAACAAGCGCTGCGCGATAAGATTCGAAAT
CTGTACGTGGCGGATTACACCAACACTTGGCGTGCGGCGTTAAATGAAATCGACATGAAATATTTCAGCG
ATATCAATGATGCCGTCACGGTGCTGGACAACCTGACGGGCAACATCGAACCGCTGCAACGTCTGCTGCG
TACACTCGACGATAACACCAAGATGTTTGCCGCCTTGCCAAAAGACGACAGCGCGCAGAAAGAGCTGCTC
AAGAGTCCCAAATATAAAGTGGCCTCGATGATCGAAGCGCCGTTCTCTGATTTGAACAACATGATCAAAC
CTGTTGGTGATAAGCCTGCGTATCTTCATGAAGTGTTGGCATCGGTGGAAGAGCTGAAGAACTACCTGAA
ATCCATTCAGGATGCACCGGATGTTGGCATGGCAGCGCTTGATGCGACCAAAGCGCGAGTGAAGCTCGTC
AATGCAGACCCAATCTATACCTTGAAACGCATCGCGTCTGGCCTGCCCAAACCGCTCGATACGATGGTCG
CCAAACTGGCGGATGAGAGCTGGTATGTGGTGAAACAAGAGGCGATCAAACACCTCGAAGTGCGTTGGCA
TGAAGATGTCTACAAGACGTTCGAAGAGAAACTGGCGGGGCGTTATCCGTTCAATGCCGCATCGAAAAAA
GATGCGTCACTGGAAGATTTCGAAGCTTTCTTTGCTCCGAATGGTACGCTGGATAGCTTCTACAACAATC
AGTTGCGCATGTTCATCGAAGAGAACATCACGGTGAATAACGACGACACCTCGCAGTCGATCATTCGCAA
AGACGTGCTCAGTCAGATCAAACAGGCGCAAAAAATCCGTGAAGCCTTCTTTAACCGCAAAGGCATTTTG
GATGTCAGCTTCTCAGTTGAACCGCTGCGTTTGAGTGGCAATAAACGCCGCAGTGTATTGAATGTCGATG
GTCAATATCTGGCGTATAGCCATGGTCCGCGCGATAGCGTGGAGCTGATTTGGCCAAACACGCTACGGGA
CTCGGCTGTGTCGAAAGTGACGCTGGTTCCGACCCAAACCAACATGTCACCACGCAGCATCAATATTCAG
GGGCCGTGGGCATTCTTCCGCCTGCTTGACCAAGGGGACGTGGTGGCCGCGAGTACCACGTCGGTGGATT
ACAAATTTGCGGTGGATGGCGGCGATATGATTTACCGCATCAACGCTGAAGCCGATGCCAACCCATTTAC
GGAACGTCTGTTCAGATCGTTCAAACTGTCTAAAACCTTGTATTAA
 Primer design