SecReT6
Protein ID: 375134264
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000646
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]680214..680534 [+]
Producthypothetical protein
NoteTssM
UniProt IDF0KJQ3, F0KJQ3
KEGG IDacc:BDGL_000646
PDB IDNA
Domain hit(s) vs Pfam DUF4381 [PF14316], Evalue: 0.0018, Aligned region: 10..76
MSC [PF09402], Evalue: 0.0065, Aligned region: 8..79
Protein Sequence: 106 a.a.     [Download]
>gi|375134264|ref|YP_004994914.1| hypothetical protein BDGL_000646 [Acinetobacter calcoaceticus PHEA-2]
MALMSSYTSIPRHIFWALATAYVLGLIVYGIYWLIQRRKHAAQGEELAEAIEKDNQAEYGKNKDKEELQL
VSQQMKESIQLIRKSKLGDKKGNAALYELPWYPSRR
 
Nucleotide Sequence: 321 bp     [Download]
>gi|375133618|ref|NC_016603.1|:680214-680534 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
GTGGCATTGATGTCTTCATATACTTCAATTCCTCGTCATATATTCTGGGCTTTAGCAACTGCCTATGTTT
TGGGTCTTATTGTTTATGGTATCTATTGGCTTATTCAACGAAGAAAGCATGCTGCTCAAGGTGAAGAGTT
AGCTGAGGCAATCGAAAAAGATAACCAAGCTGAATATGGCAAAAATAAAGATAAAGAAGAGCTTCAGCTA
GTTAGTCAACAAATGAAAGAATCAATTCAACTGATTCGTAAATCTAAGTTGGGTGATAAAAAAGGGAATG
CTGCATTATATGAGCTTCCTTGGTATCCCAGCCGCAGGTAA
 Primer design