SecReT6
Protein ID: 375134265
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000647
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]680503..683370 [+]
Producthypothetical protein
NoteTssM
UniProt IDF0KJQ4
KEGG IDacc:BDGL_000647
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.60E-71, Aligned region: 63..325
IcmF-related [PF06761], Evalue: 1.30E-54, Aligned region: 337..361
IcmF-related [PF06761], Evalue: 1.30E-54, Aligned region: 371..712
DUF1215 [PF06744], Evalue: 2.20E-22, Aligned region: 649..672
DUF1215 [PF06744], Evalue: 2.20E-22, Aligned region: 735..765
DUF1215 [PF06744], Evalue: 2.20E-22, Aligned region: 844..949
Protein Sequence: 955 a.a.     [Download]
>gi|375134265|ref|YP_004994915.1| hypothetical protein BDGL_000647 [Acinetobacter calcoaceticus PHEA-2]
MSFLGIPAAGKSSAIYNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDTAGRYSVYSEDHSEWL
GFLNILKKNRSKAPVNGLILIVSIAELISQSPENSLKLAKNLRARIQDLTERLEVVVPVYLVFSKMDLIA
GFTEFFEFYEAQEYNQAWGATLPYEQNSSHNAVDLFEKHYTILYDGLKGVSSTHLSRRHSQNISPSVMTF
PLEFKTLKPALKSFIGTLFEDNPYQFQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLTQIAQNDLKDHS
KITPNHGYFLNGLFSDVILKDKDLVKQHVNTGRKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLIGEVQ
ADLNKVVQLERASGQQLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLKGVKQI
VLTPTQQNIAQYLQRVKNNETTLKANHTNVEIKQTAQSQQYLEPSDTNPQDAYNALKAYLMMSNPQYMDA
SHLSDQVTRFWRSWLDANKGQMPRADMIQEAEQILSYAMTLANDKQFPVLEADSQIVDQTRQVLLSVVRG
MPARDRVYNEIKMRAAVRFPALTVSQIVGETNKNIVLGSYALPGVFTQKAWNDYVEKAIEEAADKPTDSK
DWVLNSRQSDDLTFSGSPEQIRKQLTALYKQEYIAEWRKFLSGIHYAKAGQFAQQVKNIDVLGEPQNSPI
RTLIERVAVETNWDNPVVQAELAAPQKGFIAWFKRKVLNHDDKQVANQVANNAQGAISQEYQMFYQLVRK
RDDQQGKSLLDEYMTNLALVRSKFNELKNAGEIGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFNEI
DQRLLQKLVVSPLTQAFESLITPTQDEINKLWVMQAYQPFTANLAKKYPFNSSASLQATSSEIGQILGEN
GSISRFVKESLDPFVIRRGYTLTSKTWKDLGISLNPQSSQWYGNW
 
Nucleotide Sequence: 2868 bp     [Download]
>gi|375133618|ref|NC_016603.1|:680503-683370 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGAGCTTCCTTGGTATCCCAGCCGCAGGTAAAAGTTCAGCTATCTATAACTCTGGTTTAAAGTTTCCTT
TTGAAGAAACACATCAGAAAATGGTATCAGCTGGCTTAAGTGGTACTCGAAATTGTGACTGGTTCTTCTC
TACAGAAGGTATTTTGCTCGATACAGCGGGCCGTTATTCTGTTTATAGCGAAGATCATTCTGAGTGGTTA
GGTTTCTTAAATATTTTAAAAAAGAACCGCTCTAAAGCACCAGTTAATGGTTTGATTCTAATTGTTAGTA
TCGCTGAGTTAATTAGTCAAAGTCCTGAAAACTCATTAAAGCTTGCTAAAAATTTACGTGCTCGTATTCA
AGATCTAACTGAACGTTTAGAAGTGGTAGTACCTGTTTATTTAGTCTTTTCAAAGATGGATTTGATTGCA
GGTTTTACCGAGTTTTTTGAATTTTATGAAGCTCAAGAATATAACCAAGCTTGGGGGGCAACGCTTCCAT
ATGAGCAAAATTCTTCTCATAACGCGGTAGATTTGTTCGAAAAACATTACACCATTCTTTACGATGGTCT
AAAAGGGGTAAGTTCGACTCATTTAAGTCGCCGTCATTCGCAAAATATCTCACCAAGTGTAATGACTTTC
CCATTAGAGTTTAAAACATTAAAACCAGCTTTAAAGAGCTTTATTGGTACACTTTTTGAAGATAACCCAT
ATCAATTTCAACCTGTTTTCCGTGGGTTTTACTTCACTAGTGCTTTGCAGGAAGGTGTAATTGAAAGTCC
AATGACTGAACAAATTGCACAAGAATTCCAACTTACACAAATTGCTCAAAATGATTTAAAAGACCATTCA
AAAATTACTCCTAACCATGGCTATTTCTTAAATGGTCTATTCTCAGATGTTATTTTAAAAGATAAAGATC
TCGTTAAGCAGCATGTAAATACGGGCAGAAAACGTCAACGTTACATTGCATTTATTGGTGCTTTAGCGGG
TGTTTCAATTATTTTGGGTGTATGGGTTTGGTCTTATCGTAATAACCAGCAATTAATTGGTGAAGTTCAA
GCAGATTTAAATAAAGTCGTTCAATTAGAAAGAGCCTCTGGTCAGCAACTATCTACTCAATTAGAAGCTT
TATTGATTCTTCAAAGACGTTTACAGCAGTTAGATGAGTTTGATGAAAATAGACCACTTAAGTTTAGTTT
TGGTTTATATCAGGGCAATGAGCTTCGTGAAAAGCTAAAAGCTGAATATTTAAAAGGTGTTAAGCAGATT
GTGTTAACACCAACACAGCAAAATATTGCTCAATATTTGCAACGTGTAAAAAATAATGAAACAACATTAA
AAGCGAACCACACGAATGTTGAGATCAAGCAAACTGCTCAATCTCAACAATATTTGGAACCTTCAGATAC
CAATCCTCAAGATGCTTATAATGCATTAAAAGCGTATTTGATGATGAGCAATCCGCAATATATGGATGCT
AGTCATCTAAGCGATCAGGTTACGCGTTTCTGGCGTTCTTGGTTAGATGCAAATAAAGGCCAAATGCCAC
GTGCAGATATGATTCAAGAAGCTGAACAGATCTTGTCGTATGCAATGACCTTAGCAAATGATAAACAATT
CCCAGTTTTAGAAGCAGATTCGCAAATTGTTGATCAAACTCGTCAAGTATTGCTCTCTGTTGTTCGAGGG
ATGCCAGCGCGTGATCGTGTTTATAACGAAATAAAAATGCGTGCTGCGGTGCGTTTCCCAGCACTGACTG
TAAGTCAGATTGTGGGGGAGACAAATAAAAATATTGTATTGGGTAGTTATGCATTACCAGGCGTATTTAC
CCAAAAAGCTTGGAATGACTATGTAGAAAAAGCAATTGAGGAAGCTGCAGATAAGCCAACAGACAGTAAA
GACTGGGTGTTAAATAGTCGACAATCTGATGATTTAACTTTCTCGGGTAGTCCAGAACAAATTAGAAAGC
AGCTAACAGCGCTTTATAAGCAAGAATACATTGCTGAATGGAGAAAATTCTTAAGTGGTATTCATTATGC
TAAAGCTGGCCAATTTGCTCAGCAAGTAAAAAATATTGATGTTTTAGGTGAGCCGCAAAACTCTCCAATT
AGAACATTAATTGAAAGAGTTGCAGTCGAAACAAACTGGGATAATCCGGTTGTTCAAGCTGAGCTTGCAG
CTCCACAAAAAGGATTTATTGCATGGTTTAAACGTAAAGTTTTAAATCATGATGATAAGCAAGTTGCTAA
TCAAGTGGCAAACAATGCCCAAGGCGCTATTTCTCAAGAATACCAAATGTTCTACCAGTTGGTTCGCAAA
CGTGATGATCAACAAGGTAAGTCATTACTTGATGAATATATGACAAATTTAGCACTCGTTCGTAGTAAGT
TTAATGAGCTTAAAAATGCGGGCGAAATTGGGCCTAATGCAATGACATTAGTCAAACAGACCCTAAATGA
GCAAACGTCTGTATTTAACCAAACTCAAAAAATTGTAGATGAAAAGATGGCGGTTGGTTTCAATGAAATT
GATCAGCGTTTACTGCAAAAATTAGTAGTTAGCCCACTTACGCAAGCTTTTGAGAGTTTAATTACACCGA
CACAAGACGAAATTAATAAATTATGGGTAATGCAAGCCTATCAACCATTTACAGCAAATCTTGCTAAGAA
ATATCCATTTAACTCATCAGCTTCTTTACAAGCAACAAGTAGTGAAATTGGTCAAATCTTGGGTGAGAAC
GGTAGTATTTCTCGCTTTGTAAAAGAAAGTCTTGATCCATTTGTGATTCGTCGTGGCTATACGTTAACGT
CTAAAACTTGGAAAGATTTAGGCATTAGTTTAAATCCTCAATCCAGCCAATGGTATGGCAACTGGTGA
 Primer design