SecReT6
Protein ID: 375134266
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000648
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]683357..683920 [+]
Producthypothetical protein
NoteTssM
UniProt IDF0KK59, F0KK59
KEGG IDacc:BDGL_000648
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 187 a.a.     [Download]
>gi|375134266|ref|YP_004994916.1| hypothetical protein BDGL_000648, partial [Acinetobacter calcoaceticus PHEA-2]
MATGELNAQAQAAPATNQSNFQFYPIPNPQLLSYTVDIDGQRMTYENGVQQWVNFIWPNQGSIPGARITA
VDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGFEMLWRSKTDPSLFVKMNFRLISSNSGSIGSSRGYA
GMQLVDKVTADKAARVVSAQQAPAQAAPARTENPVSALAQSSAGVKP
 
Nucleotide Sequence: 564 bp     [Download]
>gi|375133618|ref|NC_016603.1|:683357-683920 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGGCAACTGGTGAGTTGAATGCTCAAGCGCAAGCTGCTCCAGCGACTAACCAATCTAACTTCCAGTTCT
ACCCAATTCCAAACCCACAATTGCTTTCATATACCGTTGATATTGATGGTCAGCGTATGACTTATGAAAA
TGGTGTTCAGCAATGGGTTAACTTCATTTGGCCAAACCAAGGCAGTATTCCAGGTGCTCGTATTACCGCT
GTAGATTTACAAGGCCAAACCCACACGATTTTTGATGAGCCAGGTGAGTACGGTATTAACCGTTTAATTG
ATAGTGCTCAACGTAAAGAACAAAATGGCGGATTTGAAATGCTTTGGCGTAGTAAAACTGATCCATCATT
ATTTGTAAAAATGAATTTCCGTCTAATTAGCAGTAATTCAGGCAGTATTGGTTCAAGCCGTGGTTATGCA
GGTATGCAACTGGTTGATAAAGTCACTGCCGACAAAGCAGCTCGTGTGGTGTCTGCTCAGCAAGCGCCAG
CTCAAGCTGCTCCAGCAAGAACTGAAAATCCTGTTTCAGCACTTGCTCAGTCTTCTGCGGGAGTTAAACC
ATGA
 Primer design