SecReT6
Protein ID: 37524370
SecReT6 ID50
T6SS typei1
Gene symbolpmt1
Locus tagplu0359
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]382431..385976 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ7N9H7
KEGG IDplu:plu0359
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.30E-82, Aligned region: 512..826
ImcF-related_N [PF14331], Evalue: 1.40E-66, Aligned region: 209..465
DUF1215 [PF06744], Evalue: 1.80E-37, Aligned region: 312..326
DUF1215 [PF06744], Evalue: 1.80E-37, Aligned region: 920..1039
Protein Sequence: 1181 a.a.     [Download]
>gi|37524370|ref|NP_927714.1| hypothetical protein plu0359 [Photorhabdus luminescens subsp. laumondii TTO1]
MNWLSLLLNNIKKPARPRLPPLKATASLILALLPCLALIWLWWWGPGWQFKQTHPLDTLSARWLATVIIL
LLALSFIGIKIWRRLRQLEKLKLEGELNTVDPVRADITRQDRYLHHWKAQLQRHLGTRDYLYQRPWYLVM
GNTGSGKTALIQAGCRLTDIAAPDTLSGEEALPLHLRCWLGEKAVIIDPDGFLIDQISPPDTGKPQLPAR
LWQALLVWLTENRQRQPLNGIILTVDIHRLLTDNKAQRERVIAALHLRLQDLRLTLHHPLPFYLVLTKLD
RLHGFSAAFQSLDSAQRAQILGVTFSLNARDEQSWRTELAQFWHQWMQQLNAAMPDMMLNKVDISQRSPL
FSFTRQIQGLHSYLVPLLEGLLDNSGPAQPGLRGVYLTSSQQIGQMDDLFTQSAAVQYHLGPQAFPTWPV
ADTVPYFTHALFEAVLLAEPNLAAENRRWLSRHRHTLLTFSAVGAAVVLALWSGWHYYYQQNYRAGDEVL
AQANIFLSVPPPTGEDRLGNLQLPLLNPLREATLAYGDYHQKGLLADMGLYQGAAVGPYVENTYLQLLSQ
RFLPALMNGLLDDLNRAPKGSEEKLAVLRIMRMLEDGSGRHKSLVEHYLQARWSQAFNGQRPLQAQLLTH
LDYALDHTDWRAAREAGDQAAISRFAPYQLPLINAEKELSQLSIYQRVYQNLRIKAQDSLPPPLNLRDQI
GPGFDRLFMANNDKQLIIPQFLTINGLNNYFVKQDDQLIDLTVMDSWVLNLSHNVQYSDTDRQEIQRQIT
EQYLGDYTATWRAAMNNLDIRDFTDIPQALSALEQVISGEQPISRALQILSDNTRLPEINETLPAKARQP
LRDTPDYRLRVRIHREFAPETAVLEESGDKNSTLQGVYQQLAALHRYLLGIQNAPVPGKAALNAVQQRLE
QHNDDPIFDVQQRAKTLPAPLNRWVGALAEQAWRVVMREAIRSLEIEWHDTVVRQYQTYLAGRYPFNPDA
TEEVPLSEFGRFFRPGGTLDAFYQQNLKPFVENNLTHRADGQQLIRPDVLEQLKRADRIRDTFFSPQNGL
GVQYAIEPLSLTGNKRRSLLNLDGQLLDYAHGRSSIVHLIWPNAMRAGVESQLTLIPDAGGKSPRAIRFT
GPWAQLRLINSGKLTNVRQDSFDVRFTVDGGDMTYRLYVDESDNPFAGGLFSQFRLPDTLY
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c385976-382431 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAACTGGCTTTCTCTGCTGCTCAACAATATCAAAAAACCGGCGAGGCCGCGTCTGCCGCCCCTGAAAG
CCACCGCCTCGCTGATACTGGCCCTCCTGCCCTGTCTGGCCCTCATCTGGCTCTGGTGGTGGGGCCCCGG
CTGGCAGTTTAAGCAGACGCATCCGCTGGACACCCTGTCTGCCCGCTGGCTGGCGACGGTGATCATCCTC
CTGCTGGCCCTGAGTTTTATCGGGATAAAAATCTGGCGCCGCCTGCGCCAGCTTGAAAAACTTAAGCTGG
AGGGGGAACTGAACACCGTCGATCCGGTGCGCGCCGATATCACCCGTCAGGACCGTTATCTCCATCACTG
GAAAGCGCAACTGCAACGCCATCTGGGGACCCGGGATTATCTCTACCAGCGCCCCTGGTACCTGGTGATG
GGTAACACCGGCAGCGGCAAAACCGCCCTGATTCAGGCCGGCTGCCGGCTGACTGACATTGCCGCCCCGG
ACACCCTGAGCGGGGAAGAGGCGCTGCCCCTGCATCTGCGCTGCTGGCTGGGGGAGAAAGCCGTCATCAT
TGACCCGGACGGGTTCCTTATCGACCAGATATCGCCGCCGGACACCGGCAAACCCCAGCTGCCCGCCCGC
CTGTGGCAGGCGCTGCTCGTCTGGCTCACCGAAAACCGTCAGCGCCAGCCGCTCAACGGCATCATCCTGA
CGGTGGACATTCACCGCTTACTGACCGACAACAAAGCGCAGCGGGAACGGGTTATTGCCGCGCTTCACCT
GCGCCTGCAGGATCTGCGATTAACTCTGCATCATCCTCTGCCTTTCTATCTGGTGCTGACCAAACTCGAC
CGGCTGCACGGTTTCAGCGCCGCTTTCCAGTCGCTGGACAGCGCGCAGCGCGCCCAGATCCTGGGCGTCA
CCTTTAGCCTGAATGCGCGGGATGAGCAGAGCTGGCGCACTGAGCTGGCCCAGTTCTGGCACCAGTGGAT
GCAGCAGCTCAACGCGGCCATGCCGGACATGATGCTCAACAAAGTCGATATCAGTCAGCGCAGTCCGCTG
TTCAGCTTCACCCGCCAGATACAGGGGCTGCACAGCTATCTGGTGCCGCTGCTGGAGGGGCTCCTCGACA
ACAGCGGCCCGGCACAGCCGGGCCTGCGGGGGGTTTATCTCACCTCGTCTCAACAAATCGGCCAGATGGA
TGACCTGTTTACCCAGTCTGCCGCCGTGCAGTATCATCTGGGGCCGCAGGCTTTTCCCACCTGGCCGGTG
GCGGACACCGTGCCCTACTTCACCCACGCGCTGTTTGAAGCGGTCCTGCTGGCCGAACCGAATCTGGCGG
CTGAAAACCGCCGGTGGTTAAGCCGCCACCGCCACACACTGCTGACCTTCTCCGCCGTGGGTGCCGCCGT
GGTGCTGGCCCTGTGGAGCGGCTGGCACTATTACTATCAGCAGAACTACCGGGCCGGTGACGAGGTCCTG
GCGCAGGCCAACATCTTCCTGTCGGTGCCGCCGCCCACCGGCGAAGACCGTCTCGGCAATTTACAGCTTC
CCCTGCTCAATCCGCTGCGTGAGGCCACGCTGGCCTACGGGGATTACCATCAGAAAGGGCTGCTGGCGGA
TATGGGGCTCTATCAGGGCGCAGCGGTCGGCCCGTATGTGGAAAACACCTACCTGCAACTGCTGTCTCAG
CGCTTCCTGCCGGCCTTAATGAACGGCCTGCTGGATGACCTGAACCGGGCACCGAAAGGCAGCGAAGAAA
AACTGGCCGTCCTGCGTATCATGCGGATGCTGGAAGATGGCAGCGGCCGCCATAAATCACTGGTCGAACA
CTATCTGCAGGCGCGCTGGAGTCAGGCGTTTAACGGCCAGCGCCCGTTGCAGGCGCAGTTACTGACGCAT
CTGGACTATGCGCTGGATCACACCGACTGGCGGGCCGCACGGGAGGCGGGCGATCAGGCCGCTATCAGCC
GCTTTGCACCTTACCAACTGCCGCTCATCAATGCCGAGAAAGAACTGAGTCAGCTCTCGATTTATCAGCG
GGTCTACCAGAACCTGCGCATTAAAGCCCAGGATTCACTGCCGCCGCCCCTCAACCTGCGCGACCAGATT
GGCCCGGGCTTTGACCGCCTCTTTATGGCCAATAATGACAAGCAACTGATTATCCCGCAGTTCCTGACGA
TAAACGGCCTGAACAACTACTTCGTCAAACAGGACGACCAGCTGATCGACCTCACCGTCATGGACAGCTG
GGTGCTGAACCTGTCACACAACGTGCAGTACAGCGACACGGACCGGCAGGAAATCCAGCGACAAATCACT
GAGCAGTACCTGGGAGACTACACGGCCACCTGGCGCGCGGCCATGAACAACCTGGATATTCGTGATTTCA
CCGATATCCCGCAGGCCCTCAGCGCCCTTGAACAGGTCATCAGCGGCGAACAGCCCATCAGCCGGGCCCT
GCAAATCCTGAGCGACAACACCCGTCTGCCGGAGATTAACGAGACGCTGCCGGCCAAAGCCCGGCAGCCG
TTACGTGATACCCCGGATTACCGCCTGCGGGTGCGTATTCACCGGGAATTCGCGCCGGAAACCGCGGTGC
TGGAGGAGTCCGGGGACAAAAACAGCACCCTGCAGGGGGTTTATCAGCAACTGGCGGCCCTGCACCGTTA
CCTGCTGGGCATTCAGAACGCGCCGGTCCCGGGGAAAGCCGCCCTGAATGCCGTTCAGCAGCGGCTTGAA
CAGCATAACGACGACCCGATTTTCGACGTACAGCAGCGGGCGAAAACCCTGCCGGCACCGCTCAACCGCT
GGGTCGGCGCACTGGCGGAACAGGCCTGGCGGGTGGTGATGCGGGAAGCCATCCGTTCGCTGGAAATCGA
ATGGCACGACACCGTCGTCAGACAGTACCAGACCTACCTGGCCGGCCGCTATCCGTTTAACCCGGACGCG
ACGGAGGAGGTGCCGCTCAGTGAGTTCGGGCGGTTCTTCCGGCCCGGCGGCACGCTGGATGCCTTCTATC
AGCAGAACCTGAAACCGTTTGTGGAAAACAACCTGACCCACCGCGCGGACGGCCAGCAACTTATCCGCCC
GGATGTGCTGGAACAGCTGAAACGGGCCGACCGTATCCGCGACACCTTCTTCTCGCCGCAAAACGGTCTG
GGGGTCCAGTATGCCATTGAGCCCCTCAGCCTGACCGGCAATAAACGCCGCAGCCTGCTCAATCTCGACG
GCCAGCTGCTCGATTACGCCCACGGCCGCAGCAGCATTGTGCACCTCATCTGGCCCAACGCGATGCGGGC
CGGGGTGGAAAGCCAGCTCACGCTGATACCGGATGCCGGCGGCAAATCCCCGCGCGCCATCCGCTTCACC
GGCCCGTGGGCCCAGCTGCGCCTGATTAACAGCGGCAAACTGACTAACGTACGTCAGGATTCGTTTGATG
TGCGGTTCACGGTGGACGGGGGCGACATGACCTACCGTCTCTACGTGGATGAATCCGACAACCCGTTTGC
CGGCGGCCTGTTCAGTCAGTTCAGACTGCCTGACACCCTGTATTAA
 Primer design