SecReT6
Protein ID: 375259195
SecReT6 ID521
T6SS typeN/A
Gene symbol-
Locus tagKOX_12000
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]2590439..2591467 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDG8W869
KEGG IDkox:KOX_12000
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.20E-68, Aligned region: 20..302
Protein Sequence: 342 a.a.     [Download]
>gi|375259195|ref|YP_005018365.1| type VI secretion protein [Klebsiella oxytoca KCTC 1686]
MDDNKPGLPPFWLDAEGRDRTPAFNFYRFCQLVERLSDTKLGTGRSPENDPVRFRPHPGVGFPAGELRTT
ETDPELPDAPPTVRTNFLGLYGVASPLPTAFIDDITRGREGHEAMMAFLDIFNHRIMTQFYRIWRKYNYP
ATFEPGGTDATSRYLMALAGIARPREQPASHLLAILPSLLHSTHTAEGIAAVIRSQAPFTLVKVKPHYPV
LMPVDEHAQLSMDNSRTQGEHLVLGDEISDVNYCSAVELYTDDPDESRGWMPDGQLKKDVFTLMRTYLGC
DYDVRLWLTLPTGLLPRPRLGDLGLFSGYNIMLGLDERPPAEDLPQTARIHVGRLRERNDAG
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c2591467-2590439 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGACGACAACAAACCCGGACTCCCTCCGTTCTGGCTGGACGCTGAAGGACGCGACCGCACGCCAGCGT
TTAATTTTTATCGTTTCTGCCAGCTTGTCGAACGACTGAGTGATACAAAGCTGGGTACGGGTCGCTCGCC
AGAAAACGACCCGGTACGTTTCCGTCCACATCCGGGGGTGGGTTTCCCGGCAGGCGAATTGCGCACCACC
GAAACCGACCCGGAGCTGCCGGATGCACCGCCCACAGTCAGAACAAACTTCCTCGGGCTGTACGGCGTGG
CTTCGCCACTGCCAACCGCGTTTATCGACGACATTACCCGTGGCCGGGAAGGTCATGAGGCGATGATGGC
GTTTCTGGATATATTCAACCACCGCATCATGACGCAGTTTTACCGTATCTGGCGTAAGTACAACTACCCG
GCAACCTTTGAGCCGGGTGGCACAGATGCCACATCACGGTATCTGATGGCGCTGGCCGGCATCGCCCGCC
CGCGCGAACAACCGGCTTCACACCTGCTTGCAATACTGCCGTCGCTGCTGCATTCCACCCACACCGCAGA
GGGTATCGCCGCCGTTATCCGCTCACAGGCGCCTTTCACGCTGGTGAAGGTGAAACCTCATTACCCGGTA
CTGATGCCAGTGGATGAGCACGCGCAGTTGTCGATGGATAACAGCAGAACACAGGGGGAGCATCTGGTGC
TCGGCGATGAAATCAGCGACGTGAATTACTGCTCCGCTGTGGAGCTGTACACCGACGATCCGGATGAGTC
CAGGGGCTGGATGCCGGACGGGCAACTGAAGAAGGATGTCTTCACGCTGATGCGAACGTATCTCGGCTGC
GACTACGATGTGCGACTCTGGCTCACGTTGCCCACAGGGCTGCTACCCCGCCCGCGTCTGGGCGACCTGG
GGTTGTTTTCCGGTTACAACATTATGCTGGGGCTAGATGAGCGGCCGCCCGCGGAGGATTTGCCGCAGAC
CGCCAGAATACATGTGGGGCGGTTAAGGGAGCGCAACGATGCTGGCTGA
 Primer design