SecReT6
Protein ID: 375259196
SecReT6 ID521
T6SS typeN/A
Gene symbol-
Locus tagKOX_12005
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]2591467..2593254 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDG8W870
KEGG IDkox:KOX_12005
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.30E-127, Aligned region: 5..594
Protein Sequence: 595 a.a.     [Download]
>gi|375259196|ref|YP_005018366.1| type VI secretion protein [Klebsiella oxytoca KCTC 1686]
MDHDFLRYYDSEIRYLKEAAKEFAQKFPDVARQLGIDSVSLKTDESVEQLFQGFAFMMAQVRRKIDDDIP
ELTEPLLSHLLPVVNRTLPSTAVVELTPPQPENHLREQTLPAGTELLSLPVSTMQYQRGNRCPYRTVSDL
VIHPFSLATISRYTRTEGGHALRLRFNVIPQTDEQQISLNDIPLYLNGERPLQAALYLALSQHVSRVRIR
YGGETEQHPADIHFSPRWHAPQSALWPESDSPALCGEVRPWLEYFSNPSRFFFMTLHSSTPLTLPPECSH
FELDIALSALMPTNLPVPEEAIRMHCVPVINLFRLAGEPLVTQPAQLDYRLRPHRLIDGHTEIYSVDTVS
QKDEEDETEYPYVPYHHFRHKGGMLQYEQEWPERFFHTRTWRGVSGMHETLLMLGGRTHEQLPGVRLLLN
LTCTNGAFPRMSLQQALFDTDYSTGNLSLRGRTRSLPSRPCYPPTTPRYQWEVMSLLHPRALSFLINNVE
NLRFALGLFDWMGGRNNRRRIDGITGVSYRQAYNASHQWHGVRIHVELDEAQFSGLGDARLFSELLEQFF
TQYASIARFTQLTVVLSQSGIEWAWPERCIHRVLM
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c2593254-2591467 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGACCACGATTTTTTGCGCTATTACGACAGTGAAATACGTTATCTGAAAGAGGCGGCTAAAGAATTTG
CGCAGAAGTTTCCGGACGTCGCCAGACAGCTCGGCATAGACTCAGTGTCACTTAAAACTGATGAGTCGGT
GGAACAGTTGTTTCAGGGATTCGCCTTTATGATGGCGCAGGTACGCCGTAAGATTGATGACGATATCCCC
GAACTGACCGAGCCGCTGCTTTCCCATCTGCTGCCGGTAGTGAACCGCACTCTGCCCTCCACGGCGGTGG
TGGAGTTGACACCACCACAACCGGAAAACCATCTGCGTGAGCAGACGCTGCCTGCCGGAACGGAACTGCT
GAGTCTGCCGGTCAGCACCATGCAGTACCAGCGCGGCAACCGCTGCCCGTACCGCACCGTCAGCGACCTG
GTGATTCACCCGTTTTCTCTGGCTACCATCAGCCGCTACACGCGAACGGAGGGCGGCCATGCGCTGCGCC
TGCGTTTTAACGTTATCCCGCAGACGGATGAGCAGCAAATCTCCCTGAATGATATCCCGCTGTACCTGAA
CGGCGAACGTCCGCTACAGGCGGCGCTGTATCTGGCGCTGAGTCAGCATGTCAGTCGTGTCCGCATTCGT
TACGGCGGTGAGACGGAGCAACATCCTGCGGATATTCATTTCTCCCCGCGCTGGCATGCTCCACAATCTG
CCCTGTGGCCGGAGAGCGACAGCCCGGCGCTGTGCGGCGAGGTACGCCCGTGGCTTGAATATTTCAGCAA
CCCATCGCGCTTTTTCTTTATGACCCTGCACAGTTCCACGCCGTTAACCCTGCCACCGGAATGTTCACAC
TTCGAACTGGATATTGCCTTAAGTGCGCTGATGCCGACTAACCTGCCCGTCCCTGAAGAGGCCATCCGGA
TGCACTGCGTCCCGGTGATTAACCTGTTTCGACTGGCGGGGGAGCCACTGGTGACGCAACCGGCGCAACT
GGATTACCGCCTGCGCCCGCACCGCCTAATCGACGGCCATACCGAAATCTACAGCGTGGACACGGTAAGC
CAGAAAGATGAAGAGGACGAAACGGAATATCCGTATGTGCCTTACCATCATTTTCGCCATAAGGGCGGTA
TGCTGCAATACGAGCAGGAGTGGCCGGAGCGTTTCTTCCACACCCGCACCTGGCGCGGCGTGAGCGGGAT
GCATGAAACGTTGCTGATGCTCGGCGGCAGAACCCATGAACAGCTTCCCGGTGTGCGTCTGCTGCTGAAT
CTCACCTGCACCAATGGCGCGTTTCCGCGTATGTCGCTCCAACAGGCGCTGTTTGACACGGATTACTCCA
CCGGGAACCTGAGCCTGCGCGGGCGCACCCGCAGCCTGCCCTCCCGTCCCTGTTATCCGCCGACCACGCC
GCGTTATCAGTGGGAGGTCATGTCGCTGCTACATCCCCGTGCGCTGAGTTTTCTCATCAACAACGTTGAA
AACCTGCGCTTTGCCCTGGGACTGTTCGACTGGATGGGGGGCAGGAACAACCGGCGGCGTATCGACGGCA
TCACCGGCGTCAGTTATCGCCAGGCATATAACGCATCGCACCAGTGGCACGGTGTGCGTATTCATGTGGA
ACTGGATGAAGCGCAGTTCAGCGGTCTGGGGGATGCCCGGTTATTCAGCGAACTGCTGGAACAGTTTTTC
ACCCAGTACGCCAGCATCGCCCGTTTTACACAACTGACGGTAGTACTGAGCCAATCCGGAATCGAATGGG
CCTGGCCGGAGCGGTGTATCCACAGGGTGCTGATGTGA
 Primer design