SecReT6
Protein ID: 375259197
SecReT6 ID521
T6SS typeN/A
Gene symbol-
Locus tagKOX_12010
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]2593325..2593786 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDG8W871
KEGG IDkox:KOX_12010
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.70E-26, Aligned region: 17..138
Protein Sequence: 153 a.a.     [Download]
>gi|375259197|ref|YP_005018367.1| type VI secretion lipoprotein [Klebsiella oxytoca KCTC 1686]
MMMSASWRICGALLTVLSLAGCGLAQRAGQGATAVTDAIFYRKVDTLHLTLAARNALNTDEDGMSSPVEV
RIWPLRNATTFNLADYRSLLKQGPEVLSKDLSAPYQAIRLTPGQQTHLDMPLADDTQFVALTAFFSGPIR
CVTTGSSSFRVMP
 
Nucleotide Sequence: 462 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c2593786-2593325 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGATGATGTCCGCTAGCTGGCGTATCTGCGGCGCTTTACTGACAGTCCTCTCCCTGGCAGGCTGTGGTC
TGGCACAGCGCGCCGGACAAGGGGCAACGGCGGTGACAGACGCCATTTTTTACCGGAAGGTGGATACCCT
GCATCTGACACTGGCCGCCCGTAACGCGCTGAACACCGATGAAGACGGGATGTCGTCGCCGGTGGAGGTG
CGGATCTGGCCACTGCGTAACGCCACAACGTTTAACCTGGCCGATTACCGCAGCCTGCTCAAACAGGGGC
CTGAGGTGCTGAGCAAAGACCTGAGCGCGCCATACCAGGCAATACGCCTTACGCCAGGGCAGCAAACACA
TCTGGATATGCCACTCGCTGACGACACGCAGTTTGTTGCACTGACGGCATTTTTTTCTGGCCCGATACGG
TGCGTAACAACTGGAAGCTCATCATTCCGCGTGATGCCCTGA
 Primer design