SecReT6
Protein ID: 375259198
SecReT6 ID521
T6SS typeN/A
Gene symbol-
Locus tagKOX_12015
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]2593770..2597096 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDG8W872
KEGG IDkox:KOX_12015
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.70E-62, Aligned region: 397..702
IcmF-related [PF06761], Evalue: 5.70E-62, Aligned region: 766..826
DUF1215 [PF06744], Evalue: 3.60E-33, Aligned region: 832..952
Protein Sequence: 1108 a.a.     [Download]
>gi|375259198|ref|YP_005018368.1| ImcF domain-containing protein [Klebsiella oxytoca KCTC 1686]
MSKALHLMLLLLAILLMALCQTQAQAWFVDESTLRIAQAGILLGYFLLARLGFAFQLLSFSRPADKKQEE
SERVFWRLHNEHRRHRQPWLLVTWQAQTVEALLPGLTSERWQRSLSATLLWCGEPGNIAQEDIALFRRLR
GRRVLNAVLWVTDITPPSGMARLPGLENSSPDEFNDGVMRTLWQQLRDIARTLSWRPPLYTLCVRDSVHD
QYDRPRQSVGIALSPAQETNIQTQLHTLLPQLTGQGMAQLSLQPRWNWLLQVSHDIQHATGSRITTALQP
FVRRGSETPLCGLFFMPPALPGQHMGQHACSLSAAWSEPVAQIRHARGERDHLIAGDWLVRGTVAFLGLW
GAGMLLSALFNYRLVQADMALLLPEKKARPVAEQVRQQQERQARMDTLLYRSREGAPWWYRFGLNQNDAL
LAAMWPVWQQQNQTLLVAPLAEQLRSHLRQYMALPPGSAQRRTLTAETYRQLKAYLMLTQPERAEPEFLK
KVLLPLWQNPARGITPGEWMMLSSDMLDFYARELPAHPAWRLPAYSTMIANVRTLLRSQKGIQNSENTLY
QQVLQQVAQRHADITLNDLPGDAGSGDLFYSNASLPGMFTREAWRQNVREAIDQVAAGRQIHTDWVLDDT
GRTSPVLSEEALRTRLAERYFTDYSNAWLEFLNSLRWRQADSLSSAIDQLTLLGDVQRSPLVALGKTLRW
QAGIGQEETTMGTSLLESVKQRVSGQESTDARTAKTADPASVVTQTFAPLLAVLPPDENQPGQTKNSATP
VSGLTLQDYLIQVTQARLSLRQVSTSPDPQAMTLALAQDAFSRRDNPLTVARSQGELLAASLGQDWSGFA
DAAFVQPLAQAWQSVLAPAQQAMNEAWRTQIVQPWQDAFSGRYPFASSENDASPALLAHFIAPQQGVTEQ
FLRQQLGGLLDKQGDVWVPSALNSQGMKFSPAFLDAVNLLTQLGQAFFMQGELHTEFDIQMYPMRNVVET
DLQIDSAMMKYFNQQAEWQTFTWPDKQSAQPQAVLSYSRNQGENIGPVRTAFQADGPWALLRLLEKAQRE
KTDSGRWRLSWPAEDGVGLSLNLRAQRYNGPLDLLKLRRFKLPEQVFIQDDGGNDDVR
 
Nucleotide Sequence: 3327 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c2597096-2593770 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAGTAAAGCGCTTCATCTGATGTTATTGCTGCTGGCGATACTGTTGATGGCGCTGTGCCAGACGCAGG
CACAGGCATGGTTTGTGGATGAATCCACCCTGCGGATTGCCCAGGCGGGCATTCTGCTGGGCTATTTTCT
GCTGGCGCGACTGGGTTTTGCCTTTCAGCTACTCTCTTTCTCCCGGCCAGCGGATAAAAAACAGGAAGAA
AGCGAACGGGTATTCTGGCGTCTGCACAATGAACACCGGCGTCACCGTCAGCCCTGGCTGCTGGTCACCT
GGCAGGCGCAGACCGTGGAAGCCCTGCTGCCGGGTCTGACCAGTGAACGCTGGCAGCGCAGCCTGTCCGC
CACTCTGCTGTGGTGCGGCGAGCCGGGAAACATTGCTCAGGAAGACATCGCCCTGTTCCGCCGTCTGCGC
GGGCGGCGGGTGCTGAACGCGGTGCTGTGGGTGACGGACATTACGCCGCCTTCGGGTATGGCGCGTCTGC
CAGGGCTGGAAAACAGCAGCCCTGACGAGTTTAACGACGGAGTCATGCGCACGCTCTGGCAGCAGTTACG
GGATATTGCCCGCACGCTGAGCTGGCGGCCCCCGCTGTACACCCTCTGCGTGCGCGACAGCGTGCATGAC
CAGTACGACCGACCGCGCCAGAGTGTGGGTATTGCCTTGTCCCCTGCGCAGGAAACCAATATTCAGACGC
AACTGCATACCCTGCTCCCGCAACTGACCGGACAGGGAATGGCGCAACTGTCCCTTCAGCCGCGCTGGAA
CTGGCTGTTGCAGGTGTCGCACGATATCCAGCACGCCACCGGCAGCAGAATTACCACGGCCCTGCAACCG
TTCGTCCGGCGCGGGAGCGAAACCCCACTCTGCGGATTGTTTTTCATGCCCCCCGCCCTGCCGGGTCAGC
ATATGGGCCAGCACGCCTGTTCACTGTCTGCGGCCTGGTCAGAGCCTGTGGCGCAGATACGTCACGCCAG
GGGAGAACGCGACCACCTGATTGCAGGCGACTGGCTGGTGCGTGGCACCGTTGCATTTCTGGGACTATGG
GGAGCGGGAATGCTGCTCTCGGCACTGTTTAATTACCGTCTGGTTCAGGCAGATATGGCGTTGCTGTTGC
CGGAGAAAAAAGCGCGACCGGTCGCGGAGCAGGTGCGTCAGCAACAGGAGCGTCAGGCACGCATGGATAC
CCTGTTATACCGCAGTCGCGAAGGTGCTCCCTGGTGGTATCGCTTCGGTCTGAACCAGAATGATGCGCTG
CTGGCGGCCATGTGGCCGGTCTGGCAACAGCAAAACCAGACGCTGCTGGTTGCACCACTGGCGGAACAGC
TTCGCAGCCATTTACGCCAGTATATGGCGCTGCCGCCCGGCTCGGCGCAGCGCCGCACGCTGACAGCAGA
AACTTATCGCCAGTTGAAGGCGTATCTGATGCTGACGCAACCGGAACGGGCAGAGCCGGAATTTCTGAAA
AAGGTGTTGTTGCCGTTATGGCAGAACCCGGCCCGCGGTATAACGCCCGGTGAATGGATGATGCTCTCGT
CCGATATGCTGGATTTTTACGCGCGCGAACTGCCTGCGCACCCGGCCTGGCGACTCCCGGCATACAGCAC
CATGATTGCGAATGTTCGTACCCTGCTGCGCAGTCAGAAAGGGATACAGAACAGTGAGAACACGCTTTAT
CAGCAGGTTCTGCAACAGGTTGCGCAGCGTCATGCCGATATCACCCTCAACGACCTGCCGGGGGACGCTG
GCAGCGGCGACCTGTTCTACAGCAATGCGTCACTTCCCGGTATGTTTACCCGCGAAGCCTGGCGGCAGAA
TGTCAGGGAGGCCATCGATCAGGTGGCAGCCGGACGGCAAATCCACACCGACTGGGTGCTTGATGATACC
GGACGAACCTCCCCGGTGTTAAGTGAAGAGGCACTGCGTACCCGTCTGGCGGAACGTTACTTTACCGACT
ACAGCAACGCCTGGCTGGAATTCCTCAACAGTCTGCGCTGGCGTCAGGCAGACTCGCTCTCTTCGGCCAT
TGACCAGCTTACCCTGCTGGGGGACGTACAACGCTCCCCGCTGGTCGCGCTCGGTAAAACCCTGCGCTGG
CAGGCAGGTATCGGGCAGGAAGAGACGACGATGGGCACTTCGCTGCTGGAATCGGTAAAACAACGGGTTT
CCGGTCAGGAAAGTACGGATGCGCGCACGGCAAAAACTGCCGATCCGGCCTCCGTGGTGACGCAAACTTT
TGCGCCGCTGCTGGCGGTTTTACCCCCTGACGAGAATCAACCTGGTCAGACGAAAAACAGCGCAACGCCC
GTCAGCGGGCTGACATTACAGGATTATCTGATTCAGGTGACGCAGGCGCGTCTTTCGCTCCGGCAGGTCA
GTACCTCACCGGATCCGCAGGCCATGACGCTGGCACTGGCACAGGACGCCTTTTCCCGGCGCGACAACCC
GCTGACGGTGGCGCGCAGCCAGGGTGAGCTGCTGGCGGCCAGTCTCGGCCAGGACTGGAGCGGCTTCGCT
GATGCAGCGTTTGTACAGCCGCTTGCGCAGGCATGGCAGTCGGTACTGGCCCCGGCGCAGCAGGCGATGA
ATGAAGCCTGGCGCACACAGATTGTTCAGCCCTGGCAGGATGCATTCTCCGGGCGCTACCCCTTTGCCTC
TTCCGAAAATGATGCCTCCCCGGCGCTGCTGGCTCATTTTATAGCACCGCAGCAAGGCGTGACGGAGCAG
TTTCTTCGTCAGCAACTGGGCGGCCTGCTGGATAAACAGGGCGATGTCTGGGTGCCTTCCGCACTGAACA
GCCAGGGGATGAAATTCAGTCCGGCGTTTCTGGATGCGGTTAATCTGCTGACACAACTGGGGCAGGCGTT
TTTTATGCAGGGCGAACTGCATACGGAATTTGATATTCAGATGTACCCGATGCGCAATGTGGTGGAGACG
GATTTGCAGATAGACAGCGCGATGATGAAGTATTTTAACCAGCAGGCGGAATGGCAGACATTCACCTGGC
CGGATAAACAGAGCGCGCAGCCACAGGCCGTGCTTAGTTATTCCCGCAATCAGGGGGAGAACATCGGACC
GGTGCGTACTGCTTTTCAGGCCGACGGCCCCTGGGCGCTGTTGCGTCTGCTGGAGAAAGCGCAGCGCGAG
AAGACTGACAGCGGCCGCTGGCGCTTAAGCTGGCCTGCTGAGGACGGCGTCGGCCTGTCGCTGAACCTGC
GCGCCCAGCGCTACAACGGGCCGCTGGATTTGCTGAAACTGCGCCGTTTTAAATTGCCTGAGCAGGTGTT
TATTCAGGATGACGGGGGTAATGATGATGTCCGCTAG
 Primer design