SecReT6
Protein ID: 375259200
SecReT6 ID521
T6SS typeN/A
Gene symbol-
Locus tagKOX_12025
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]2598498..2598755 [-]
Producthypothetical protein
NotePAAR
UniProt IDG8W874
KEGG IDkox:KOX_12025
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.40E-17, Aligned region: 5..75
Protein Sequence: 85 a.a.     [Download]
>gi|375259200|ref|YP_005018370.1| hypothetical protein KOX_12025 [Klebsiella oxytoca KCTC 1686]
MRGVIRLGDSHSHGGNVITASGAMFDGKPVMLAGDTVSCPQHGTVPVTQGHPTWTMNGRAVIVDGCTAQC
GCVLRTSLPNAGADC
 
Nucleotide Sequence: 258 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c2598755-2598498 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGCGCGGCGTAATTCGACTCGGCGACAGCCATTCTCACGGCGGCAACGTCATCACCGCATCCGGGGCCA
TGTTCGATGGCAAACCTGTGATGCTGGCGGGCGATACCGTGAGTTGCCCGCAACACGGCACCGTGCCAGT
AACCCAGGGTCACCCAACCTGGACGATGAATGGCCGGGCGGTGATTGTTGACGGCTGCACGGCACAGTGC
GGATGCGTGCTGAGAACATCGTTGCCCAATGCCGGAGCGGACTGCTGA
 Primer design