SecReT6
Protein ID: 375259204
SecReT6 ID521
T6SS typeN/A
Gene symbol-
Locus tagKOX_12045
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]2602139..2604652 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG8W878
KEGG IDkox:KOX_12045
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-43, Aligned region: 44..354
Phage_GPD [PF05954], Evalue: 1.50E-43, Aligned region: 589..638
DUF2345 [PF10106], Evalue: 8.40E-41, Aligned region: 608..759
T6SS_Vgr [PF13296], Evalue: 9.30E-34, Aligned region: 491..596
Phage_base_V [PF04717], Evalue: 1.30E-16, Aligned region: 404..484
Sarcoglycan_1 [PF04790], Evalue: 0.002, Aligned region: 684..724
Protein Sequence: 837 a.a.     [Download]
>gi|375259204|ref|YP_005018374.1| Rhs element Vgr protein [Klebsiella oxytoca KCTC 1686]
MAIQDYIITGGKYGTYNHYQLLLKKLNQARPDIQISVLKFGGCEAISQIPRYEIVFTSATPDIPANLLIN
YSAQLLMYPDGKPYEKLKPRILPGIITQFRQCSTSADETRYVAVLEHKMARMAQGHNSAVFLNDSIISLT
EHTFGDYLIDKLSFVFKLTDRYPPRDFMLQYGESDYDHVSRRLADSGVSFYRQYDEENDEDVIVLTDHSG
GWIKGPAIPFRHPSGLFDGGLESVWDITVNRQAVPKRVQTNDDNYLQAQSDMKSEVKTHEDFRALWATDY
RWAEHYPDAGKEYEEQPGQGIWYAKRRQERHLSELITFEGKCNCMALRPGMRITVTGKTFADAPDGLLIV
STRCENVARDTAYFVTFTAVPWNNRFTYRPPLLPWPPMSGTLPARVSSEEENDTYSYIDNQGRYRIRFDL
DLKEWKKGFESCWVRLAKPYAGDTYGFHWPLLDGTGVLIAFENSDGDRPYIAHVMHDSTHPDHVAQQNHK
RNVLRTPSGNKMRMDDTRGKEHIKLSTPNNDRSQLNLGNLVDQNRKLRGEGAELRTGGWAAIRAAKGVLL
TSEAQPKAQGKQLDMAATIAQLEKALALAKTLEQTANIAQSSPVSTATQQQLSAALTSLQQPGIVVHGEA
GIAQTTPESLQHSAGKNLLATAGQDASFSVFRQFSIAVGQIFSVFVHKMGIKLIAAAGKIQIQAQKDQME
LTSFADMQLTSTNGRIVLNAKQELLLMCGGAGIRIKDGVLEQLGPTRIVQKTPNLIYQGGESISQAMPSF
NEGTFGLKYRLHRKGDPSHILKNQKFRIHRQDGSVQEGITDESGESSLLTMNELEKATVELLKGEAS
 
Nucleotide Sequence: 2514 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c2604652-2602139 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGCGATCCAGGACTACATTATTACGGGCGGTAAGTACGGCACTTACAACCATTATCAGTTACTGCTGA
AAAAGCTGAACCAGGCAAGGCCGGATATTCAGATATCGGTGTTGAAATTCGGCGGCTGTGAGGCCATCAG
TCAGATACCCCGCTACGAAATCGTATTCACCAGCGCCACGCCCGACATCCCCGCAAATCTGCTGATTAAC
TACAGCGCACAGTTACTGATGTACCCCGACGGCAAGCCTTACGAAAAACTTAAACCCCGAATTCTCCCCG
GTATTATTACGCAGTTTCGTCAGTGCAGCACCTCCGCCGATGAAACCCGCTATGTCGCGGTGCTCGAACA
CAAAATGGCGCGCATGGCGCAGGGGCACAACAGCGCGGTGTTCCTCAATGACAGCATCATCAGCCTGACG
GAACACACCTTCGGTGACTACCTGATAGACAAACTAAGCTTCGTCTTTAAGCTCACCGATCGCTACCCGC
CACGCGATTTTATGTTGCAGTATGGGGAATCCGACTACGACCACGTTTCACGCCGTCTGGCCGATAGCGG
TGTGTCGTTTTACCGTCAGTACGACGAAGAGAATGACGAAGACGTCATTGTCCTTACCGACCATTCCGGC
GGCTGGATAAAAGGTCCGGCAATCCCCTTCCGTCATCCTTCAGGTTTGTTCGATGGCGGGCTGGAATCGG
TATGGGATATCACCGTTAACCGCCAGGCGGTGCCGAAACGGGTGCAGACTAACGACGATAACTATCTTCA
GGCGCAGAGCGACATGAAGTCGGAAGTGAAAACCCATGAGGATTTTCGAGCTCTGTGGGCCACCGACTAC
CGCTGGGCGGAACATTATCCCGACGCCGGAAAAGAATATGAGGAGCAGCCCGGCCAGGGCATCTGGTACG
CGAAGCGTCGTCAGGAGCGCCACCTCAGCGAACTGATTACCTTCGAAGGGAAATGTAACTGCATGGCCCT
GCGACCAGGGATGCGAATCACCGTCACCGGTAAAACCTTCGCCGATGCGCCGGACGGGCTGCTGATTGTC
TCCACCCGCTGCGAAAACGTGGCGCGCGACACAGCGTATTTTGTCACCTTCACCGCCGTTCCCTGGAACA
ACCGCTTTACATACCGCCCGCCGCTGCTGCCGTGGCCGCCGATGTCCGGCACGCTGCCAGCCCGCGTGTC
GAGCGAAGAGGAAAACGACACCTACTCGTATATCGACAATCAGGGCCGTTACCGCATCCGTTTTGATCTC
GACCTGAAAGAGTGGAAGAAAGGCTTTGAAAGCTGCTGGGTGCGGCTGGCGAAACCTTATGCCGGAGATA
CTTACGGCTTCCACTGGCCGCTGCTGGACGGTACGGGAGTACTGATAGCGTTTGAAAACAGCGACGGCGA
TCGCCCGTATATCGCCCATGTAATGCATGATTCCACCCACCCGGACCATGTCGCGCAGCAGAACCACAAA
CGCAATGTGTTAAGAACGCCTTCCGGCAACAAAATGCGGATGGATGACACACGCGGCAAAGAGCATATCA
AGCTGTCCACACCCAATAATGACCGCAGCCAGCTTAACCTCGGCAACCTGGTGGATCAGAACCGTAAACT
GCGCGGCGAAGGCGCGGAACTGCGCACCGGGGGCTGGGCGGCGATACGCGCCGCAAAAGGCGTTCTGCTC
ACCAGCGAAGCCCAGCCAAAGGCGCAGGGCAAACAACTGGATATGGCAGCGACCATCGCGCAACTGGAGA
AAGCACTGGCGCTGGCGAAAACGCTGGAGCAGACGGCGAATATCGCCCAGTCCTCTCCGGTCAGTACCGC
CACGCAACAGCAGCTTTCCGCTGCCCTGACCTCACTGCAACAGCCCGGCATCGTGGTACATGGCGAAGCC
GGAATTGCTCAGACCACGCCGGAGTCCCTGCAACATTCCGCTGGCAAAAACCTGCTCGCCACCGCCGGAC
AGGACGCCAGCTTCAGCGTCTTCCGCCAGTTTTCCATCGCCGTCGGGCAGATATTCTCCGTCTTCGTTCA
CAAAATGGGCATCAAACTGATAGCCGCCGCCGGGAAAATTCAGATCCAGGCGCAGAAAGACCAGATGGAA
CTGACCTCGTTTGCAGATATGCAACTGACCAGCACCAACGGGCGCATTGTGCTGAATGCTAAACAGGAGC
TGCTGCTGATGTGCGGCGGTGCAGGCATTCGCATTAAAGACGGCGTGCTTGAACAGCTTGGCCCCACGCG
TATTGTACAAAAAACGCCAAACCTGATTTACCAGGGCGGAGAGAGCATCAGCCAGGCGATGCCGTCATTT
AACGAAGGGACGTTTGGCCTGAAATACCGATTGCACCGCAAGGGCGATCCTTCACATATTCTGAAAAACC
AGAAATTCCGTATTCACCGTCAGGATGGTTCCGTGCAGGAAGGCATTACAGACGAGAGTGGCGAATCTTC
ACTACTGACAATGAACGAACTGGAAAAAGCCACCGTTGAACTCCTTAAGGGAGAAGCATCATGA
 Primer design