SecReT6
Protein ID: 375260560
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18845
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4072495..4073940 [+]
Producthypothetical protein
NoteTssM
UniProt IDG8W9C8
KEGG IDkox:KOX_18845
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.90E-09, Aligned region: 83..104
IcmF-related [PF06761], Evalue: 1.90E-09, Aligned region: 399..467
ImcF-related_N [PF14331], Evalue: 0.0015, Aligned region: 159..211
ImcF-related_N [PF14331], Evalue: 0.0015, Aligned region: 282..307
Protein Sequence: 481 a.a.     [Download]
>gi|375260560|ref|YP_005019730.1| hypothetical protein KOX_18845 [Klebsiella oxytoca KCTC 1686]
MKRFLYILGAGLCVLVVLLALLFILAQTTHLFFEWTGERVFWISLLGAVFLTSLLSVLIFFLIPFQKNDT
PLTPQYSRPAGEGAGTQERDISLSSLKKHLRRRYNLFWRSKVRLLLVCGEPEHIAAIAPGLAEKQWLEGH
RTVLIYGGSLSSAPDTGRLTALRKLRRSRPLDGIVLALDERQTTAGTLDNHLRALEQVGEALRWQPPVYL
WQVTDSDWSQDARVTQTVGALFPARATPAGVERQLRAILPSLRERGMQQLCAGPSHDFLLRFGRQLEKQG
IAHWKTLLTPWLTEHLKRVPLRGLMFSPSLAPEDNAAGHEHRWSAPAIWQGVTADCAQARGVRVGMPWQR
TPGVTLLTLIALWGAGSVVSFAVNRHHIVSAAARAQQLVNHPAVNDPQLMALQALRNDIGRLQTQQANGA
PWYQRFGLDHNAPLSAALMPWYGRASNRLIRDAAMQALTQKLTVLANLPPRSPQPAARHVS
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4072495-4073940 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAAAAGGTTTTTATACATCCTGGGAGCGGGTCTCTGTGTCCTGGTTGTTTTGTTGGCGCTGTTGTTTA
TTCTGGCCCAGACAACTCATCTTTTTTTTGAATGGACGGGGGAACGCGTATTCTGGATTTCGCTGTTGGG
TGCGGTTTTTCTGACCAGTCTGTTGAGCGTGCTGATTTTTTTTCTTATCCCTTTCCAAAAAAACGACACC
CCGCTGACTCCGCAGTACAGTCGCCCGGCAGGCGAGGGGGCTGGTACACAGGAACGAGATATCTCCCTTT
CTTCGCTAAAAAAGCACCTCCGCCGCCGCTACAACCTCTTCTGGCGCAGTAAGGTCCGCCTGCTGCTGGT
CTGTGGCGAACCCGAACATATCGCCGCCATCGCCCCCGGCCTTGCCGAAAAACAGTGGCTTGAAGGCCAC
CGCACGGTGCTGATTTACGGCGGCAGCCTGTCATCGGCGCCGGACACCGGGCGCCTGACCGCCCTGCGTA
AGCTGCGCCGCAGCCGTCCGCTGGACGGCATCGTGCTGGCGCTGGATGAGAGACAGACCACCGCCGGTAC
GCTGGATAACCATCTTCGCGCCCTGGAGCAGGTCGGGGAGGCGCTGCGCTGGCAGCCGCCGGTGTACCTG
TGGCAGGTGACTGACAGCGACTGGTCGCAGGATGCGCGCGTCACCCAGACGGTAGGGGCGCTTTTCCCGG
CCCGCGCCACGCCGGCGGGGGTGGAGCGCCAGCTCCGCGCTATCCTGCCATCCCTGCGCGAAAGGGGAAT
GCAGCAGCTGTGCGCCGGGCCGTCGCACGATTTCCTGTTACGTTTCGGCCGGCAGCTGGAGAAACAGGGA
ATAGCCCACTGGAAAACGCTGCTGACGCCGTGGCTGACGGAGCACCTGAAGCGTGTTCCGCTGCGCGGCC
TGATGTTCAGCCCGTCGCTGGCCCCTGAGGATAATGCCGCGGGCCATGAACACCGCTGGTCCGCTCCGGC
GATCTGGCAGGGCGTGACGGCGGACTGCGCTCAGGCGCGGGGCGTGCGGGTAGGGATGCCGTGGCAGCGA
ACGCCGGGCGTCACCCTGCTGACGCTGATTGCCCTGTGGGGGGCGGGCAGCGTGGTCTCCTTTGCCGTTA
ACCGCCACCATATCGTCAGCGCGGCGGCGCGGGCGCAGCAGCTGGTGAATCATCCCGCGGTTAACGACCC
GCAGCTGATGGCGCTGCAGGCCCTGCGTAACGATATCGGGCGTCTGCAGACGCAACAGGCGAATGGCGCT
CCCTGGTACCAGCGCTTCGGGCTGGACCACAATGCGCCGCTCTCCGCCGCCCTGATGCCCTGGTACGGCC
GGGCCAGTAACCGCCTGATACGCGATGCGGCCATGCAGGCGCTGACGCAGAAACTGACCGTCCTGGCGAA
CCTGCCGCCGCGCAGCCCGCAGCCCGCAGCGCGCCACGTCAGCTAA
 Primer design