SecReT6
Protein ID: 375260561
SecReT6 ID522
T6SS typei2
Gene symbol-
Locus tagKOX_18850
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4073972..4075870 [+]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDG8W9C9
KEGG IDkox:KOX_18850
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.20E-50, Aligned region: 1..227
IcmF-related [PF06761], Evalue: 1.20E-50, Aligned region: 307..328
DUF1215 [PF06744], Evalue: 2.90E-37, Aligned region: 350..470
DNA_pol3_gamma3 [PF12169], Evalue: 0.0072, Aligned region: 309..375
Protein Sequence: 632 a.a.     [Download]
>gi|375260561|ref|YP_005019731.1| type VI secretion system protein ImpL, partial [Klebsiella oxytoca KCTC 1686]
MMARPDKADAALYAQVMTTTAPSRPGLSPALWQSIAPDLHAFYMQSLPSQPAWKITPDRQLVTRVRQVLL
EQIGRRNAESTLYENMLTRVRRSYADMTLEDMTPQTDAGRLFSTPESVPGMFTRQAWEGGVQEAIDNAVA
SRRDEIDWVLSDSRKTLPGDVSPEALKQRLTARYFTDFAGAWLNFLNSIRLNPAHNIADVTDQLTLAGDV
RQSPLIALMNTLAYQGQTGQQKEAISASLVKSAKNLLGGDDRPVIDQQAAGPAGPLDSTFGPLLQLMGKN
SAQSVMAADSSLSLQTYLTRLTRVRLRLQQVANAADPQAMMQQLAQTVFQGRSVDLTDTQEYGSLVAASL
GEEWSGFGQTMFVQPLTQAWETVLQPSAASLNEAWQRSVVANWNSAFKGRYPFAAAKSDASLPMLAAFIR
RDTGRIDRFLSTQLGGVLHREGSTWVADRTHSQGLTFSPAFLNAVNQLSQLSDILFTDGSQGISFELQGV
AMPEVVETQLTLDGQKLHYFNQVADWQSFRWPGVINKPGAMLTWTSTAAGTRLYTNHSGPWGVIRMLEQM
QRQKAGDGLYRLSVTAPDRRQLQWLLRTELGDGPLALLKLRNFSLPSQIFSVGVPAPGRTDEYESDVVEG
SE
 
Nucleotide Sequence: 1899 bp     [Download]
>gi|375256816|ref|NC_016612.1|:4073972-4075870 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGATGGCGCGCCCGGACAAAGCCGACGCTGCCCTGTACGCGCAGGTGATGACAACCACCGCGCCATCCC
GTCCGGGACTCTCCCCGGCGCTGTGGCAGAGTATCGCCCCGGACCTTCACGCCTTTTACATGCAGAGCCT
GCCGTCGCAGCCAGCCTGGAAAATCACGCCGGACAGGCAGCTGGTCACCCGGGTACGTCAGGTGCTGCTG
GAGCAGATTGGCCGGCGCAACGCGGAAAGTACGCTGTATGAGAACATGCTCACCCGGGTGCGCCGCAGCT
ACGCGGACATGACGCTGGAGGACATGACGCCGCAGACCGACGCCGGTCGCCTGTTCAGCACGCCGGAGTC
GGTGCCGGGGATGTTCACCCGCCAGGCGTGGGAGGGCGGGGTTCAGGAAGCCATTGATAACGCCGTGGCG
TCCCGGCGCGATGAAATCGACTGGGTGCTGAGCGATAGCCGTAAAACGCTGCCCGGCGACGTCTCCCCGG
AGGCGCTGAAGCAGCGCCTGACGGCGCGCTACTTCACCGATTTTGCCGGTGCCTGGCTGAACTTCCTCAA
CAGTATCCGGCTGAACCCGGCGCACAATATTGCCGACGTCACCGACCAGTTAACGCTGGCCGGGGACGTG
CGCCAGTCGCCGCTGATTGCCCTGATGAACACCCTGGCTTACCAGGGGCAGACCGGGCAGCAGAAAGAGG
CCATTTCCGCATCGCTGGTGAAATCGGCGAAAAACCTGCTGGGCGGTGATGACCGGCCGGTGATTGACCA
GCAGGCCGCCGGACCGGCGGGGCCGCTGGACAGCACCTTCGGGCCGCTGCTGCAGCTTATGGGTAAAAAC
AGCGCGCAGAGCGTGATGGCGGCGGACAGTTCGCTCAGTTTACAGACTTACCTGACGCGTCTGACCCGCG
TGCGCCTCAGGCTCCAGCAGGTGGCAAACGCCGCCGACCCGCAGGCGATGATGCAGCAGCTGGCGCAGAC
GGTCTTCCAGGGCAGGAGCGTTGACCTGACCGACACGCAGGAGTACGGCAGCCTGGTGGCGGCAAGCCTC
GGTGAAGAGTGGAGCGGTTTCGGGCAGACGATGTTTGTTCAGCCGCTGACCCAGGCCTGGGAGACGGTGC
TTCAGCCGTCGGCGGCCAGCCTGAACGAAGCGTGGCAGCGCTCAGTTGTCGCGAACTGGAATTCAGCGTT
TAAGGGGCGTTATCCCTTTGCTGCCGCGAAGAGCGACGCCTCGCTGCCGATGCTGGCGGCGTTCATCCGC
CGCGATACCGGACGTATTGACCGTTTCCTCAGCACGCAGCTGGGCGGCGTTCTGCACCGGGAGGGCAGCA
CCTGGGTGGCGGACAGAACCCACAGCCAGGGGTTGACGTTCAGCCCGGCCTTCCTGAACGCGGTGAACCA
GCTCAGCCAGCTGTCCGACATCCTGTTTACCGACGGCAGCCAGGGTATCAGCTTTGAACTGCAGGGGGTG
GCGATGCCGGAAGTGGTGGAAACACAGCTGACGCTTGACGGGCAGAAACTCCACTATTTTAACCAGGTTG
CCGACTGGCAGAGCTTCCGCTGGCCGGGGGTAATCAATAAACCGGGGGCGATGCTGACCTGGACGTCGAC
GGCGGCGGGAACCCGTCTGTATACAAACCACAGTGGTCCGTGGGGCGTTATCCGGATGCTGGAGCAGATG
CAGCGGCAGAAAGCGGGGGACGGGCTGTACCGGCTGAGCGTCACCGCGCCGGACAGGCGACAGCTTCAGT
GGCTGCTGCGTACGGAACTGGGCGACGGACCGCTGGCGCTGCTGAAGCTGCGAAACTTCAGTCTGCCGTC
GCAGATATTCAGCGTCGGTGTCCCGGCGCCAGGCCGCACGGATGAATATGAATCTGACGTTGTGGAAGGG
AGTGAATAA
 Primer design