SecReT6
Protein ID: 375261274
SecReT6 ID523
T6SS typei2
Gene symbol-
Locus tagKOX_22425
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]4823529..4826999 [-]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDG8WIV6
KEGG IDkox:KOX_22425
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.80E-72, Aligned region: 431..749
DUF1215 [PF06744], Evalue: 2.00E-35, Aligned region: 872..992
Protein Sequence: 1156 a.a.     [Download]
>gi|375261274|ref|YP_005020444.1| type VI secretion system protein ImpL [Klebsiella oxytoca KCTC 1686]
MRRFLSLFKKPEIVFWLLVLIVLVCSLAVVSIVYWLPERLQLIRETSAWYAWLSGSVAASIALAITGVFL
FFGARAEGKRSFSKERQNAQGDDVKTPPKKDVTPVSAAVTTRQQILNHLRRRYHLFWRRKVRLLLITGDE
AAIEQLVPGLQQQQWLEGNRTVLIYGGSLAPEPDREKYTALRKLRRGRPLDGIVRVMPQSLNLAPQISDS
DLRGLEKISELLRYSAPVWLWQLCDSNWSQGMRPEQAVGASFPLRAKEDDIIRQLERMLPALRAQGVSQV
AENNSHDFLLRLGQHLQDGGIVRRAQQLLPWLYDSQQRIPLRGLMFSLPENKSASTSAGTADAEQYIPEL
QRHALTLPATWQGIVDDCTRVRGRRVGMAWERTLAWTLMTIIVVWGAGMLLSFTVNRQQIVSVAEQAHAL
VAHPSVSDNQLTALHTLRNDAGRLQHNAQEGAPWYQRFGLDHNQQLLDALLPWYGVANNRLIRDPANEAL
KQKLSALANSAPNSDQRAQLAKPGYDQLKAWLMMARPDKADGAFYAQTMKTVQPTRTGISAGLWQSLAPD
LWAFYISELPAQPKWVITPDAQLISQSRQVLLQQIGRRNAESTLYENMLKSVRRNFADVSLEDMTGGTDA
RRLFTTEEVVPGMFTRQAWDGGIQQAIEKAANSRRDEIDWVLSDSRKAVSSDLSPEALKARLTQRYFTDF
AGSWLSFLNSLQLNPANNIADVTDQLTLMSDVRQSPLIALMNTLAWQGQTGQQSEGLSDSIIKSAKDLVG
GKDKPVIDQSASGPQGPLDETFGPLLQLLGKNKGSNVMSADNTLSLQTYLTRITRVRLRLQQVASASDPQ
AMMQTLAQTVFQGKSVDLTDTWQYGSLISASLGEEWSGFGSTMFVQPLTQAWETVLQPSAASLNDKWSRS
VVANWQTAFDGRFPFAASKSDASLPMLAEFVRKDSGRIERFLTTELSGVLHKEGSQWVPDKVNSQGLSFN
PAFLRAINQLSQLSDILFTDGSQGISFELQARPVPQVVETQLTIDGQKLHYFNQMADWQSIRWPGDTYKP
GTMLTWTTVNAGARLFGDYSGTWGFIRWLNLGKRQQLDRSQWMMSFTAPDGRTLQWVLRSQLGKGPLALL
ELRGFTLPDQIFSVDSAATAQALMTKTEDSDMDGTE
 
Nucleotide Sequence: 3471 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c4826999-4823529 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGAGGCGATTCCTCTCGCTATTTAAAAAACCGGAAATTGTGTTCTGGCTTTTGGTGTTAATTGTGCTGG
TTTGCAGCCTTGCCGTGGTGAGTATCGTCTACTGGCTGCCTGAAAGGCTACAGCTCATCAGGGAAACCTC
CGCCTGGTATGCCTGGTTGAGCGGTTCTGTGGCAGCAAGTATTGCACTGGCCATAACTGGAGTATTTCTT
TTCTTTGGTGCGCGAGCTGAAGGTAAACGTAGCTTCAGTAAAGAGCGGCAAAATGCGCAGGGTGATGATG
TTAAGACGCCACCAAAGAAAGATGTAACACCAGTATCTGCTGCAGTGACGACCCGTCAACAAATTCTCAA
CCACCTTCGTCGTCGCTACCATCTTTTCTGGCGTCGCAAAGTCCGTCTGCTGCTGATCACCGGCGATGAA
GCTGCTATCGAACAGCTGGTTCCCGGCCTGCAACAGCAGCAGTGGCTCGAAGGCAACCGCACCGTGCTGA
TTTACGGTGGCAGCCTGGCACCGGAGCCTGACCGTGAAAAATACACCGCATTACGCAAGCTGCGCCGCGG
ACGCCCGCTGGACGGGATTGTCCGCGTCATGCCGCAGTCACTTAACCTGGCCCCGCAAATCAGCGACAGC
GATTTACGCGGGCTGGAAAAAATCAGCGAACTGCTGCGTTATTCCGCCCCGGTCTGGCTGTGGCAGCTGT
GCGACAGCAACTGGTCGCAGGGTATGCGTCCTGAGCAGGCTGTGGGGGCAAGTTTTCCCCTACGCGCAAA
AGAAGACGATATTATCCGCCAGCTGGAGCGGATGCTCCCGGCCCTGCGGGCGCAGGGGGTAAGCCAGGTC
GCTGAGAACAACAGCCACGACTTCCTGCTGCGTCTGGGCCAGCACCTCCAGGACGGCGGTATCGTCCGCC
GGGCTCAGCAACTGCTGCCATGGCTCTACGACTCTCAGCAGCGTATTCCGCTGCGTGGCCTGATGTTCAG
CCTGCCGGAGAATAAATCCGCCAGTACGTCAGCGGGAACAGCCGATGCTGAGCAATATATCCCTGAATTA
CAGCGCCATGCCCTGACCCTGCCGGCGACCTGGCAGGGTATCGTTGACGACTGCACCCGTGTGCGGGGCC
GCCGTGTCGGCATGGCGTGGGAGAGGACGCTTGCCTGGACACTGATGACCATCATCGTTGTCTGGGGGGC
GGGAATGCTGCTGTCGTTTACGGTCAACCGTCAGCAGATAGTCTCCGTCGCCGAACAGGCTCATGCCCTG
GTGGCGCATCCTTCCGTATCGGACAACCAGCTGACGGCCCTGCATACTCTGCGTAATGATGCCGGGCGTC
TGCAGCATAATGCTCAGGAGGGCGCCCCCTGGTACCAGCGCTTCGGACTGGACCATAATCAGCAGCTGCT
TGACGCGTTGCTGCCCTGGTACGGCGTGGCGAACAACCGCCTGATACGCGACCCGGCAAATGAGGCGCTT
AAGCAGAAGCTCAGCGCGCTGGCAAATTCTGCCCCCAACAGCGACCAGCGGGCGCAGCTGGCGAAACCGG
GCTACGACCAGCTGAAGGCCTGGCTGATGATGGCCCGGCCGGATAAAGCCGACGGCGCATTCTACGCACA
GACCATGAAAACCGTGCAGCCGACGCGGACAGGTATCTCAGCCGGTCTGTGGCAGAGCCTGGCGCCGGAT
TTGTGGGCTTTTTACATTTCCGAACTGCCTGCGCAGCCAAAGTGGGTAATCACGCCGGATGCGCAGCTGA
TCAGCCAGAGCCGCCAGGTCCTGCTGCAGCAGATAGGACGGCGCAACGCGGAAAGCACGCTGTATGAGAA
CATGCTCAAATCCGTGCGTCGTAACTTTGCCGATGTGTCTCTGGAGGACATGACTGGCGGTACCGATGCG
CGGCGACTGTTTACCACCGAGGAGGTGGTGCCGGGAATGTTTACCCGCCAGGCCTGGGATGGGGGGATTC
AGCAGGCCATCGAAAAGGCGGCGAATTCCCGCCGGGATGAAATCGACTGGGTGCTCAGCGACAGCCGAAA
AGCCGTCTCCTCAGACCTGTCGCCGGAAGCCCTGAAAGCGCGTCTGACACAGCGTTACTTCACTGACTTT
GCCGGCAGCTGGCTGAGCTTCCTCAACAGCCTGCAGCTTAATCCGGCGAACAATATTGCAGACGTTACCG
ACCAGCTGACGCTGATGAGTGACGTCCGCCAGTCGCCGCTGATTGCCCTGATGAATACGCTCGCCTGGCA
GGGACAGACCGGCCAGCAAAGCGAAGGCCTTTCGGATTCCATCATCAAATCGGCCAAAGACCTGGTCGGC
GGAAAAGACAAACCGGTGATTGACCAGTCTGCATCAGGCCCGCAGGGGCCGCTGGATGAAACCTTTGGTC
CGCTGCTTCAGCTGCTGGGCAAAAACAAAGGCAGCAACGTGATGTCGGCGGATAACACGCTGAGCCTGCA
GACTTACCTGACCCGTATCACCCGCGTGCGTCTGCGCCTGCAACAGGTGGCCAGCGCTTCTGACCCGCAG
GCGATGATGCAGACCCTGGCGCAGACCGTATTCCAGGGCAAAAGCGTGGACCTCACCGACACCTGGCAGT
ACGGCAGCCTGATTTCGGCAAGCCTTGGCGAGGAGTGGAGCGGTTTTGGCAGCACAATGTTTGTGCAGCC
GCTGACTCAGGCCTGGGAGACAGTGCTTCAGCCGTCGGCAGCCAGCCTGAATGATAAATGGAGCCGCTCG
GTTGTCGCGAACTGGCAAACTGCCTTTGACGGTCGTTTCCCGTTTGCCGCCAGCAAAAGTGATGCCTCCC
TGCCGATGCTGGCGGAGTTTGTGCGCAAGGACAGCGGGCGCATTGAGCGCTTCCTGACGACGGAGCTCAG
CGGTGTGCTGCACAAGGAGGGCAGCCAGTGGGTGCCGGATAAGGTCAACAGTCAGGGGCTGAGCTTCAAC
CCGGCCTTCCTGCGGGCCATTAATCAGCTGAGCCAGCTGTCGGACATTCTGTTTACCGATGGCAGTCAGG
GCATCAGCTTTGAGCTGCAGGCGCGCCCTGTGCCGCAGGTGGTGGAAACGCAGTTGACCATTGATGGGCA
AAAGCTGCACTACTTTAACCAGATGGCTGACTGGCAGTCCATTCGCTGGCCTGGCGACACTTACAAGCCG
GGAACCATGCTGACCTGGACCACCGTTAATGCCGGTGCGCGTCTGTTTGGTGATTACAGCGGGACCTGGG
GCTTTATTCGCTGGCTTAACCTGGGTAAGCGTCAGCAGCTTGACCGCAGCCAGTGGATGATGAGTTTCAC
CGCACCGGATGGCCGCACCCTGCAGTGGGTGCTGCGCTCACAGCTCGGAAAAGGTCCGCTGGCGCTGCTG
GAATTACGCGGCTTCACGTTGCCGGATCAGATATTCAGCGTCGACAGCGCGGCTACGGCTCAGGCGCTGA
TGACCAAAACGGAAGACAGTGATATGGACGGAACTGAATGA
 Primer design