SecReT6
Protein ID: 375261975
SecReT6 ID524
T6SS typei2
Gene symbol-
Locus tagKOX_25975
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]5603309..5606728 [-]
Producthypothetical protein
NoteTssM
UniProt IDG8WBP4
KEGG IDkox:KOX_25975
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.00E-69, Aligned region: 164..199
IcmF-related [PF06761], Evalue: 6.00E-69, Aligned region: 418..738
DUF1215 [PF06744], Evalue: 1.50E-36, Aligned region: 858..976
Protein Sequence: 1139 a.a.     [Download]
>gi|375261975|ref|YP_005021145.1| hypothetical protein KOX_25975 [Klebsiella oxytoca KCTC 1686]
MVKDNSVWRGNWGRISITALIAAAIGLAIWKKGDAFGLTSNSLKLLVSVAVIILLLLVRHGKTISLAIKQ
QWSRFQAKRKSLLPADEGRVKQTPPRNVTVDTIRAAMRNLYGRRWGRKTRILLVTGTVSEVEQLTPGLTT
QLWQEDRGTLLLWGGDLSTPADSAWLTALRKLRRRPVDGMVWVTSAFDQLSAPGLEQPLPVPSDSTMDFL
SHAISIRMEALGWQLPLYVWSLHPRAGKPEGRITQATGCLLPAGCSTEGLAEQLSALTPDLTSQGLQQTC
GEVKHNFLLTLADQLIREPESVTAPLSVILNPYRPLLLAGVVFSQPSAGAERAVPHHWGMDKRWDALPES
VRTLPAGLRPYKPGIPWRRVMASVVALTMVGWAAWMGIAYVTNRSQIDSANVQAALAARQNQPLEQRLHA
LSELQKTLSRLQYRSEFGVPWYEQAGLSQNNALLDALWPRYQDSALPLLRDAAADHLQRQLNAFNVLPAG
SPLREQMAKNTYDQLKLYLMLARPEHMDAAWFGSALLNDWPMRDGVKNGVWLGMAPSLLSFYGVQLVAHP
EWKLRADENLVSQARSLLVRLMGVRNSESTLYQKMLTQVSHLYVDMRLEDMTGDTDASRLFSTTEVVPGM
FTRQAWEQAVQPAIEKVVKARRDGLDWVLTDSKRQMNKQDETSPEALKHRLTERYFADFSGAWLEFLNSL
RWNQATTLSDSIDQLTLMADVRQSPLVALMNTLNVQGRTGQTGEAISDSLVKSAKNLLGGDNQDAIDQSA
GVHGPLDATFGPVLALMDKNRTGAQELSLQSFLTRVTQVRLRLQQVTNAADPQAMTQTLAQTVFQGKSVD
LTETRDYGSLIAAGLGLEWSGFGRTVFVQPMEQAWQQVLTPAAESLNAQWQQAVVAEWNSAFGGRYPFNN
SSSDVSLPLLAKYLNADSGRIAQFLQTRLRGVLHKEGNHWVPDSINSQGLAFNPAFLNAINTLSHISDVA
FTEGSAGMNFELRPGTADGVMQTDMIIDSQKLIYVNQLPAWKRFAWPADTEAPGANLSWVSTQAGTRQYA
DIPGAWGWIRLLDKAVVSAYPGVGSSYSLSWKAQDGRTLNYTLRTEAGEGPLALLKLRNFRLPETIFSTT
GVAESGLVASEASEVEEVY
 
Nucleotide Sequence: 3420 bp     [Download]
>gi|375256816|ref|NC_016612.1|:c5606728-5603309 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGTGAAGGATAACTCAGTGTGGCGTGGTAACTGGGGACGCATCAGTATTACTGCACTGATTGCTGCCG
CGATCGGATTAGCTATCTGGAAAAAGGGCGATGCGTTCGGACTTACCAGTAATAGCCTTAAACTGCTGGT
ATCTGTGGCGGTGATAATTCTTCTGCTACTTGTCCGCCATGGCAAAACTATTAGCCTGGCGATTAAACAA
CAGTGGTCGCGTTTTCAGGCGAAGCGTAAAAGTCTCCTGCCTGCTGATGAAGGTCGCGTTAAGCAGACAC
CGCCACGCAATGTCACCGTTGATACCATCCGTGCAGCCATGCGTAACCTCTATGGTCGTCGCTGGGGCCG
TAAAACACGCATCCTGCTGGTCACTGGCACTGTATCTGAGGTGGAGCAACTGACCCCAGGGCTCACGACT
CAGCTCTGGCAGGAAGATCGCGGCACGCTGTTACTGTGGGGCGGTGACCTCAGTACGCCAGCCGACAGTG
CCTGGCTTACCGCGCTGCGCAAACTGCGCCGCCGTCCGGTGGATGGCATGGTATGGGTCACTTCAGCGTT
TGACCAGCTCTCAGCGCCAGGGCTGGAGCAGCCGCTGCCGGTACCTTCAGACAGCACCATGGATTTCCTG
TCTCACGCCATCAGCATACGTATGGAAGCGCTTGGCTGGCAGCTCCCGCTGTATGTCTGGTCCCTGCACC
CACGCGCCGGTAAACCGGAAGGGCGCATTACGCAGGCAACCGGCTGTTTGTTACCTGCCGGTTGCAGTAC
CGAAGGGCTGGCAGAGCAACTGTCCGCCCTGACGCCAGATTTGACTTCACAGGGGCTGCAGCAGACCTGC
GGTGAAGTGAAACATAACTTCCTGCTGACGCTTGCCGACCAGCTCATTCGTGAGCCGGAAAGCGTGACCG
CACCGCTGTCGGTGATACTCAATCCGTACCGTCCGCTTCTACTGGCCGGCGTGGTGTTCAGTCAGCCTTC
AGCCGGTGCCGAACGTGCCGTGCCGCACCACTGGGGCATGGATAAGCGCTGGGATGCCCTGCCGGAGTCT
GTCCGGACACTCCCTGCCGGACTACGTCCGTACAAGCCCGGCATTCCGTGGCGCAGGGTGATGGCGTCTG
TTGTTGCTCTTACGATGGTCGGCTGGGCTGCGTGGATGGGCATCGCGTATGTCACCAACCGCAGCCAGAT
TGACAGCGCTAATGTCCAGGCGGCACTTGCCGCCCGACAGAATCAGCCCCTGGAGCAGCGCCTGCACGCG
CTGTCTGAACTGCAAAAAACGCTGTCCCGTCTGCAGTACCGCTCTGAGTTTGGCGTGCCGTGGTACGAGC
AGGCCGGACTAAGCCAGAACAATGCGTTGCTGGACGCACTCTGGCCACGTTACCAGGACAGCGCATTGCC
GCTGCTGCGGGATGCCGCCGCTGACCATCTGCAGAGACAACTTAATGCCTTTAATGTATTGCCAGCGGGC
AGCCCGCTGCGTGAGCAGATGGCAAAAAACACTTATGACCAGCTCAAACTCTACCTGATGCTGGCGCGTC
CGGAACATATGGACGCGGCCTGGTTCGGCTCTGCATTGCTGAATGACTGGCCGATGCGTGACGGTGTAAA
AAACGGCGTCTGGCTGGGGATGGCGCCTTCTCTGCTGTCGTTTTATGGCGTGCAGCTGGTTGCGCACCCT
GAATGGAAACTGCGTGCTGATGAAAATCTGGTCAGCCAGGCGCGTTCCCTGCTGGTTCGTCTGATGGGCG
TACGCAACAGCGAATCGACCCTGTACCAGAAGATGCTCACTCAGGTGTCGCACCTCTATGTCGATATGCG
CCTGGAAGACATGACCGGCGATACCGATGCATCCCGTCTGTTCAGCACCACGGAAGTCGTGCCCGGGATG
TTTACGCGTCAGGCCTGGGAGCAGGCCGTGCAGCCCGCTATCGAGAAGGTGGTGAAGGCACGCCGGGACG
GACTAGACTGGGTGCTGACTGACAGCAAGCGTCAGATGAATAAACAGGACGAGACCTCACCGGAAGCTCT
GAAACATCGCCTGACGGAACGTTACTTTGCCGACTTCAGCGGGGCATGGCTTGAGTTCCTCAACAGCCTG
CGCTGGAACCAGGCGACCACGCTGTCGGATTCCATTGACCAGTTGACCCTGATGGCCGACGTGCGTCAGT
CACCACTGGTGGCGCTGATGAACACCCTGAATGTGCAGGGACGCACCGGGCAGACAGGCGAAGCCATTTC
GGATTCGCTGGTGAAATCGGCGAAGAATCTGCTCGGCGGTGATAACCAGGATGCCATTGATCAGAGCGCT
GGTGTTCACGGCCCGCTGGATGCAACCTTTGGTCCGGTACTGGCGCTGATGGACAAAAACCGGACAGGTG
CACAGGAGTTGAGTCTGCAGTCGTTCCTGACCCGCGTGACGCAGGTGCGTCTGCGCCTGCAGCAGGTGAC
CAATGCCGCCGACCCGCAGGCGATGACACAGACGCTGGCGCAGACCGTATTTCAGGGTAAGTCGGTCGAC
CTCACCGAAACCCGTGACTACGGCAGCCTGATTGCCGCCGGTCTCGGCCTGGAGTGGAGCGGCTTTGGCC
GTACCGTGTTTGTTCAGCCGATGGAGCAGGCCTGGCAGCAGGTACTGACCCCGGCGGCCGAAAGTCTCAA
TGCCCAGTGGCAGCAGGCCGTGGTTGCTGAGTGGAACAGTGCCTTCGGTGGACGCTATCCGTTTAACAAT
TCCAGCAGTGATGTATCCCTGCCGCTGCTGGCTAAATACCTCAATGCAGATTCCGGGCGTATTGCGCAGT
TCCTGCAAACCCGCCTCAGAGGCGTGCTGCACAAAGAGGGCAACCACTGGGTGCCGGACAGCATCAACTC
GCAGGGGCTGGCCTTTAATCCGGCGTTCCTCAATGCCATCAACACCCTGAGCCATATCTCGGATGTCGCT
TTCACCGAAGGCAGTGCCGGCATGAACTTCGAGTTGCGTCCGGGCACTGCCGATGGGGTAATGCAGACTG
ACATGATTATCGACAGCCAGAAGCTGATCTATGTAAACCAGTTGCCGGCGTGGAAGCGCTTCGCCTGGCC
TGCAGATACCGAGGCTCCGGGGGCGAACCTGAGCTGGGTAAGCACGCAGGCAGGAACCCGTCAGTACGCC
GATATCCCTGGCGCCTGGGGCTGGATACGTCTGCTCGATAAAGCTGTGGTCAGTGCTTATCCGGGCGTTG
GTAGCAGTTACAGCCTGAGCTGGAAAGCACAGGACGGGCGCACGCTCAATTACACCCTGCGTACCGAGGC
GGGCGAGGGGCCACTGGCGCTGCTGAAACTGCGCAACTTCCGTCTGCCGGAGACGATTTTCAGCACGACT
GGCGTGGCCGAATCAGGCCTGGTCGCCAGCGAGGCCAGCGAAGTAGAAGAGGTCTACTGA
 Primer design