SecReT6
Protein ID: 37526201
SecReT6 ID51
T6SS typei4b
Gene symbol-
Locus tagplu2288
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]2687306..2690815 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ7N4N7
KEGG IDplu:plu2288
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-31, Aligned region: 171..377
ImcF-related_N [PF14331], Evalue: 1.90E-31, Aligned region: 615..636
Protein Sequence: 1169 a.a.     [Download]
>gi|37526201|ref|NP_929545.1| hypothetical protein plu2288 [Photorhabdus luminescens subsp. laumondii TTO1]
MKKLFYAIGWLSVMVILLLLSLTIAVAFSWPTIGGLLLFICLLLLLLLLRVAMAFMPEIMNKLRWLNKFW
RKGNNRLEYLLYQHWRQGGYLQSWRRFRSLLHRNEPVPPWFLVVGERGNGKQKLLTRCNVVPMTGKNLPA
LTENTFTCRWWFFRRAMYMVVSGRYTEGQSLYRQAWLRLISWIAQVRKPAGVLVCLSVEQLLNSDNRALY
IAARQVRAQLEPLQIRLERRLPIWLILTHSETLPGFDHWCTQLSVEQHAELLGDFIEHHTVGNVTDVLDK
SMNTIVNTLKMMRLKLLNQQRQQPNAEILALPETVAQLQPALGCYLNALFDQDHYLEHGLLRGLFFTAEH
QTAGVFSQRLLGEYLPDQVQHSQDQRSHNVLLTGWRTLTKRVCVSLLSLMLVYGVGNALMTTWRGVTQLE
NIHEADPLERSYLRYQKVEYWLQETLPSLFFYPVTHTMEQRMAQQYQQQAPVGAFNPESVAAHLLARFHN
AETPQKRLLVLHWARFINIEQAMTHGATLETLQRMPAYSASLLSGENDPLSAEQRVALRLAQYRQGNAQQ
AFDQWRNVLQTLLEDSNNWQWLLADEQPTGTHSLTLADFWPLASDDVATINTRIRGIYTQAGEQDIQATL
GELAQALNRPAFFTPLQRSFYQQYQNQRQSEWLAFAQAMPQGEMLVRGKKNWQALILAAGQYDSPYITFL
TQLERDLSSIEQADRQPWLQTQQRLWQLHGYVQKSGMMQRVSLGNFSVRQRIMSWLGISPQISVRLDDTA
LTRYRAYRQAVQLNSQRELLSDMETEVLVKNALNNEKGELDDSGLRALFNRFTLWHHETESKQSAGVNET
LWRLYQGDAHLVLRYAFLSAASRLQTQWESKVIWPMEKLSRQELFDGRELNARLYEYSNAFVRDTAGYAL
DIRPEGIKRQEIEDVVFPFSDDFIFYINNLIQPNDLLSATSDIRRRLQEKLALLESEQQLTTAQQEPEQE
QKPSAEVTIVSQPATANRGAKVLPVGSSVTLSCDDGVQQLKSMNFNDSMTLHWSPGTCGKVQIDIYFPRF
TLSKSYIGSDGLLQFMHAFSRGELTLAAQAFPQRRDELSALGINNITVRYQVSESTAVSTLYQQWQQHQQ
QQTALLEQRNRLDSQLLNLSEPTVAKGTLSTLPSQITTHWNELRKPKSE
 
Nucleotide Sequence: 3510 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c2690815-2687306 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAAAAAATTATTTTATGCCATTGGCTGGCTTAGCGTGATGGTTATCCTTTTATTACTCAGTTTAACTA
TTGCGGTGGCATTTTCATGGCCGACAATAGGTGGTTTATTACTATTTATTTGCCTATTACTGTTGTTATT
ATTGCTGCGTGTGGCAATGGCATTCATGCCAGAAATAATGAATAAACTGCGCTGGTTAAATAAATTCTGG
CGGAAAGGAAATAACCGTCTGGAATATTTACTCTATCAGCACTGGAGACAAGGAGGATATTTACAAAGTT
GGCGTCGATTCCGTTCACTGTTACACCGTAACGAACCCGTTCCACCGTGGTTTCTGGTGGTAGGGGAACG
GGGCAATGGTAAACAGAAGTTGTTAACACGCTGCAATGTGGTGCCCATGACGGGGAAAAATCTGCCAGCG
CTGACAGAAAACACCTTTACCTGTCGCTGGTGGTTCTTCCGCCGGGCAATGTACATGGTTGTTTCCGGCC
GTTATACCGAAGGTCAATCCCTGTACCGGCAAGCCTGGTTGCGTCTAATCAGTTGGATCGCACAAGTACG
TAAACCCGCTGGCGTACTCGTTTGCTTATCGGTGGAACAGTTGCTAAACAGCGACAATAGAGCGCTCTAT
ATCGCCGCACGTCAGGTACGTGCTCAGTTGGAACCATTACAGATACGTCTGGAACGCCGCTTACCCATCT
GGCTGATCCTTACCCACAGCGAAACATTGCCGGGGTTTGACCATTGGTGCACCCAACTGTCAGTAGAACA
ACATGCTGAATTGCTAGGCGATTTTATCGAGCATCATACGGTGGGTAATGTCACCGACGTGCTGGATAAG
AGCATGAACACCATTGTTAACACGTTGAAAATGATGCGCCTTAAGTTGCTCAATCAGCAACGGCAGCAAC
CCAATGCAGAAATCTTAGCGTTACCAGAAACGGTAGCTCAACTGCAACCTGCACTGGGTTGTTACTTGAA
TGCACTGTTCGACCAAGACCATTATCTGGAGCATGGTCTGTTGCGTGGCCTGTTTTTTACCGCCGAGCAT
CAAACTGCTGGCGTTTTCAGCCAACGTTTGTTGGGAGAATACCTGCCAGATCAAGTTCAACATAGCCAAG
ATCAACGTAGCCATAACGTATTGCTGACTGGCTGGCGGACATTGACCAAACGCGTATGCGTTAGCCTACT
CAGTTTGATGCTGGTGTACGGTGTCGGCAATGCATTGATGACGACCTGGCGTGGCGTTACGCAACTTGAA
AATATCCATGAGGCAGACCCGCTTGAGCGGAGTTACTTGCGCTACCAAAAAGTTGAATACTGGTTGCAGG
AAACCTTGCCATCTCTGTTTTTCTATCCGGTCACCCATACGATGGAACAACGGATGGCACAGCAATACCA
GCAACAAGCACCTGTTGGTGCATTCAACCCGGAGTCGGTAGCGGCACACTTACTAGCACGTTTCCATAAC
GCGGAAACACCGCAAAAACGACTGTTGGTTTTACATTGGGCACGCTTTATTAACATAGAACAGGCAATGA
CACATGGCGCTACGCTAGAAACTTTACAGCGTATGCCTGCTTATTCAGCTTCACTATTAAGTGGTGAAAA
CGATCCTTTATCCGCGGAACAACGCGTCGCACTTCGTCTGGCGCAATATCGCCAAGGCAATGCACAGCAA
GCATTTGATCAGTGGCGAAATGTATTGCAAACACTACTAGAAGATAGCAATAACTGGCAGTGGCTATTAG
CCGACGAACAACCGACTGGCACGCATTCGCTGACACTGGCTGATTTCTGGCCGCTCGCCAGCGATGATGT
TGCCACAATTAACACACGTATTCGTGGTATCTATACCCAAGCAGGTGAGCAAGATATTCAGGCAACCTTA
GGAGAACTGGCACAAGCCCTTAACAGACCGGCATTCTTTACTCCTTTACAGCGCTCGTTTTATCAACAGT
ATCAAAATCAGCGCCAATCAGAGTGGTTAGCATTCGCTCAGGCTATGCCTCAAGGAGAGATGTTAGTTCG
AGGCAAGAAAAACTGGCAAGCGCTGATATTAGCAGCGGGCCAATATGACAGCCCCTATATCACCTTTCTG
ACCCAGCTAGAACGTGATTTATCCTCGATAGAGCAGGCGGATCGGCAGCCTTGGTTACAGACACAGCAGC
GTTTATGGCAACTGCATGGTTATGTGCAAAAAAGTGGCATGATGCAACGAGTCTCGCTAGGGAATTTCTC
TGTGCGCCAGCGCATCATGTCATGGCTTGGAATTTCACCGCAGATCTCGGTACGGCTGGATGATACCGCG
CTGACACGCTATCGCGCCTACCGACAGGCGGTGCAGTTAAATAGCCAACGCGAGTTGCTCAGTGATATGG
AAACCGAGGTGTTGGTTAAAAATGCGCTAAATAACGAGAAAGGAGAGTTGGATGATAGCGGTTTACGCGC
ATTGTTTAACCGTTTCACCCTGTGGCACCATGAGACTGAAAGCAAACAGAGTGCAGGAGTAAATGAAACC
TTATGGCGGCTCTATCAGGGTGATGCGCATCTGGTACTGCGTTACGCCTTCTTAAGTGCTGCCAGCCGCT
TGCAAACTCAGTGGGAAAGCAAAGTGATTTGGCCGATGGAAAAATTGAGCAGACAGGAACTGTTTGATGG
CCGGGAATTGAACGCGCGTTTGTATGAATACAGCAATGCATTTGTACGGGATACCGCAGGGTATGCGCTG
GATATCCGTCCTGAAGGGATTAAACGTCAGGAAATAGAGGATGTAGTCTTTCCGTTTAGCGACGATTTCA
TTTTCTATATCAATAACCTCATTCAACCGAATGACCTACTTTCAGCGACATCGGATATTCGCCGTCGTCT
GCAAGAGAAACTCGCCTTATTGGAAAGCGAACAGCAACTGACGACAGCACAGCAGGAACCGGAGCAAGAA
CAGAAGCCATCGGCGGAAGTAACCATTGTCAGTCAGCCGGCGACCGCTAACCGGGGGGCAAAAGTATTGC
CAGTAGGCAGTTCAGTGACGTTGAGTTGTGATGATGGCGTACAGCAGCTTAAGAGTATGAATTTCAATGA
CAGCATGACGCTGCACTGGAGCCCAGGAACATGCGGTAAAGTACAAATTGATATCTATTTTCCTCGCTTT
ACCCTAAGCAAAAGTTACATTGGCTCCGATGGTTTGCTGCAATTTATGCACGCTTTCTCCCGCGGTGAAC
TGACATTAGCAGCTCAAGCGTTCCCGCAACGGCGGGATGAATTAAGTGCGCTGGGTATCAATAACATCAC
TGTGCGCTATCAAGTCAGCGAAAGCACAGCGGTTTCAACACTCTACCAACAATGGCAGCAACATCAGCAA
CAACAAACGGCGTTATTGGAACAACGCAACCGACTGGATAGCCAGTTGTTAAATTTAAGTGAACCTACAG
TGGCAAAGGGAACTCTCTCTACTTTGCCATCACAGATCACCACCCATTGGAACGAATTAAGGAAACCTAA
AAGTGAGTAA
 Primer design