SecReT6
Protein ID: 37527121
SecReT6 ID52
T6SS typei2
Gene symbol-
Locus tagplu3238
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3830821..3834171 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ7N256
KEGG IDplu:plu3238
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.30E-77, Aligned region: 394..712
DUF1215 [PF06744], Evalue: 9.10E-36, Aligned region: 239..285
DUF1215 [PF06744], Evalue: 9.10E-36, Aligned region: 837..955
Protein Sequence: 1116 a.a.     [Download]
>gi|37527121|ref|NP_930465.1| hypothetical protein plu3238 [Photorhabdus luminescens subsp. laumondii TTO1]
MVKTLILLIGTITLLVSLAGLGWWVWGEHRTTDAETFNHLLWVCGIAWVLTVVVSMLGFITVTLFVKNKV
TDVKSDTRPLLPASEPYDYGDLGDRMRLRYGRFWWYKVRILLVVGEVEQVEAIAPGLTTTHWQEGYRTLL
LWGGSLQAEPNTAQLMALRRLRRYRPLNAIVWALTENQSAQPVWMDKALRMLQKQAHQLRWQAPVYLWQV
CHSTWSQEGRITQTVGCFFPERCTPDIVATQLQTLVDPLRERGMQQLLEKTAHDFLCRLSANLKQQGIAH
WQQVLTPWLAEYGDVVSLRGLMFSLPLKAQTTRLPQIWLPDTAWQGVLEGSRCFHGRRVGMLHTQTVCRG
LIVLGLLWGAGMMLSFFTNRDQLAVVQAAVTDLKAQPENSDAQLMALKALRNEVDRLQDRAEHGVPWYER
FGLSQNQKLLTAVVPDYAQVNNRLIRDKAAAVLHAKLSALVNLPPGSPLRAKRAKAGHDQLKAYLMMAQP
EKVDAAFLTRILDENEPERAGIAPAVWLDTAWDLWSFYAENLAAHPEWRITPDKALIKQVRQLLLIQPGK
HNAEAALYQQMLQSVEKNYSDLTLRQMTGDTDAARLFTTSHVIPGMFTRQAWEGGIQKAIAEAVASRKEA
IDWVLSDNRQAVSASVSPEELKARLTARYFTDFAGAWQDFLNSLRWNKTRNLSDVIDQLTLMADGRQSPL
IALMNTLAYQGETGQQGPSLSDSLVKSAKTLLNKKTPRMINQQTAGLHGPMDETFGPLLALMGENQAEGR
IKADSTLNLQTFLTRVTDVRLKLQQMNNSDDPPAMANALAKTVFEGKSTDLTDTQGYGRLIAASLGGQWR
GFGQTLFVEPLAQAWQGVLKPATANLNSQWQTAIVDNWDRAFAGRYPFAGGESEISLPMLGQFIRSDSGR
IEQFLTRQLGGILHKAGNQWVVDEVNGQGVQINPDFLKAINQLSQLSDLLFADGSQGLRFELRARAVRDV
VETDLTIDGQKLRYFNQMESWQSFRWPGETYKPGVMLTWTSVNAGARLFGDYQGNWGLIRWLAQAKAEKL
DESRYRLIFTAPDGLPLTWILRTELGEGPLALLKLRGFKLPKNIFVVTPGNHTTISAVNDDDLIEE
 
Nucleotide Sequence: 3351 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3834171-3830821 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
GTGGTGAAGACACTTATCTTACTGATAGGCACCATTACCCTGCTGGTTTCGTTGGCTGGTCTGGGATGGT
GGGTTTGGGGAGAACACCGAACCACTGATGCCGAAACTTTCAACCATCTGTTGTGGGTTTGTGGAATAGC
TTGGGTGCTCACTGTGGTGGTGAGTATGCTAGGTTTTATCACGGTAACGTTGTTTGTCAAAAACAAAGTC
ACCGATGTGAAGTCCGATACCCGGCCACTTTTGCCAGCCAGCGAACCGTATGATTATGGTGATTTGGGCG
ATCGCATGCGCCTCCGTTACGGGCGGTTCTGGTGGTATAAAGTCCGCATTTTACTGGTGGTGGGCGAAGT
GGAACAGGTGGAAGCCATCGCGCCGGGGCTGACCACGACGCACTGGCAGGAGGGTTATCGCACGCTGTTG
CTCTGGGGCGGCAGTTTGCAAGCGGAACCGAATACCGCTCAATTGATGGCCCTGCGTCGCTTGCGCCGTT
ACCGCCCGCTCAATGCCATTGTCTGGGCGCTGACCGAAAACCAAAGTGCGCAGCCGGTGTGGATGGATAA
AGCTTTGCGGATGTTACAAAAACAGGCCCACCAGTTGCGCTGGCAGGCCCCGGTCTACCTGTGGCAGGTG
TGTCACAGTACCTGGTCTCAGGAAGGTCGTATCACTCAGACCGTCGGCTGCTTTTTTCCTGAACGCTGTA
CCCCGGATATCGTGGCGACACAGTTACAAACGTTGGTTGACCCGTTGCGCGAGCGCGGGATGCAGCAACT
GTTGGAGAAGACGGCCCACGATTTTCTTTGTCGTCTGTCCGCGAACTTGAAACAACAGGGGATTGCGCAC
TGGCAACAGGTCCTGACGCCGTGGTTAGCGGAGTATGGTGATGTGGTGTCGCTGCGGGGTTTGATGTTCA
GTTTGCCGCTTAAAGCGCAGACGACTCGCCTCCCGCAGATCTGGCTGCCCGACACGGCATGGCAGGGGGT
GTTGGAGGGCAGTCGTTGTTTCCACGGTCGGCGGGTGGGCATGCTCCACACACAGACCGTTTGTCGTGGC
CTGATAGTGCTGGGCTTGTTATGGGGGGCCGGAATGATGCTCTCCTTTTTCACCAACCGTGACCAGCTAG
CTGTGGTGCAGGCGGCGGTCACTGACCTGAAAGCTCAGCCGGAGAATTCTGATGCCCAGTTGATGGCCTT
AAAGGCGCTGCGTAACGAGGTGGACCGGCTGCAAGACCGGGCTGAACACGGTGTACCGTGGTATGAGCGC
TTTGGTTTGAGTCAGAATCAGAAACTGTTGACGGCAGTGGTGCCCGATTATGCGCAGGTTAATAACCGCC
TGATACGAGACAAAGCCGCTGCGGTGTTGCATGCGAAACTGAGTGCGCTGGTGAATTTACCGCCGGGCAG
CCCTTTGCGGGCTAAGCGGGCGAAAGCCGGTCATGACCAGTTGAAAGCCTACCTGATGATGGCGCAGCCG
GAAAAAGTGGATGCTGCGTTTTTAACCCGGATACTGGATGAAAATGAACCCGAGCGGGCCGGTATTGCCC
CCGCTGTCTGGTTGGATACGGCGTGGGATTTGTGGAGTTTTTATGCGGAGAATCTGGCCGCGCATCCCGA
ATGGCGGATAACCCCGGATAAGGCGTTGATTAAACAGGTGCGTCAGTTGTTGCTGATCCAGCCAGGTAAG
CACAATGCCGAAGCGGCGCTTTACCAGCAGATGCTGCAATCAGTGGAGAAAAATTATTCGGACCTGACGT
TAAGGCAGATGACCGGCGACACCGATGCGGCGCGGCTGTTTACCACCTCTCACGTGATACCGGGGATGTT
TACCCGTCAGGCGTGGGAAGGCGGGATACAAAAGGCGATAGCGGAGGCGGTGGCGTCACGTAAAGAGGCA
ATTGACTGGGTGCTGAGTGATAACCGTCAGGCAGTCTCGGCTTCGGTATCGCCCGAAGAGCTGAAAGCCC
GTTTGACCGCCCGTTACTTTACCGATTTTGCCGGGGCGTGGCAGGATTTTCTCAACAGCCTGCGCTGGAA
CAAAACCCGTAACCTGTCGGATGTCATCGACCAGCTAACGTTGATGGCGGATGGGCGGCAGTCTCCGCTG
ATTGCGCTGATGAACACGCTGGCCTATCAGGGCGAAACCGGGCAACAGGGGCCGAGTTTATCGGACTCAT
TGGTGAAATCCGCTAAAACGTTATTGAATAAAAAAACGCCGCGAATGATTAATCAACAGACGGCTGGCTT
GCACGGGCCGATGGATGAAACCTTTGGGCCGTTGTTGGCGCTGATGGGAGAAAATCAGGCAGAAGGAAGA
ATCAAGGCGGACAGTACCCTGAATTTACAAACCTTCCTGACGCGGGTAACCGACGTGCGTCTGAAACTGC
AACAGATGAACAACAGCGACGACCCACCGGCAATGGCGAATGCGCTGGCTAAAACGGTATTTGAAGGGAA
AAGCACTGATTTGACCGATACGCAGGGCTATGGGCGCTTGATAGCCGCCAGTCTGGGCGGCCAATGGCGT
GGTTTTGGTCAGACGCTGTTTGTCGAGCCATTAGCGCAGGCGTGGCAGGGGGTATTGAAACCGGCGACGG
CGAATCTGAATAGCCAGTGGCAGACGGCGATAGTGGACAACTGGGATCGGGCATTTGCGGGTCGTTATCC
GTTTGCCGGTGGCGAAAGTGAAATCTCATTGCCGATGTTGGGGCAGTTTATCCGGTCAGATTCAGGGCGG
ATAGAGCAGTTCTTGACGCGTCAGTTAGGCGGGATACTGCATAAAGCGGGTAACCAGTGGGTAGTGGATG
AGGTGAATGGTCAGGGCGTACAGATTAACCCGGATTTTCTAAAGGCGATAAATCAGCTCAGTCAGTTATC
GGACCTGTTGTTTGCGGATGGCAGTCAGGGATTGCGGTTTGAACTGCGGGCCAGAGCGGTGCGGGATGTG
GTGGAAACTGACCTGACGATAGATGGGCAGAAACTGCGTTATTTTAACCAGATGGAAAGTTGGCAAAGTT
TTCGCTGGCCGGGAGAGACCTATAAACCGGGTGTGATGCTGACGTGGACCAGTGTCAATGCCGGGGCGAG
ATTGTTTGGTGATTATCAGGGGAACTGGGGACTCATCCGCTGGCTGGCGCAGGCGAAAGCGGAGAAGCTG
GATGAAAGCCGTTACCGACTGATATTTACCGCGCCGGATGGATTACCGTTAACCTGGATTTTGCGCACAG
AATTGGGCGAAGGGCCGCTGGCGTTATTAAAACTGCGCGGATTTAAATTGCCGAAAAATATCTTTGTAGT
GACGCCGGGTAATCACACGACAATATCAGCGGTAAATGACGATGATTTGATAGAGGAATAG
 Primer design