SecReT6
Protein ID: 37527130
SecReT6 ID52
T6SS typei2
Gene symbol-
Locus tagplu3247
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3843641..3847012 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ7N250
KEGG IDplu:plu3247
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.10E-75, Aligned region: 401..719
DUF1215 [PF06744], Evalue: 1.20E-35, Aligned region: 246..292
DUF1215 [PF06744], Evalue: 1.20E-35, Aligned region: 844..962
Protein Sequence: 1123 a.a.     [Download]
>gi|37527130|ref|NP_930474.1| hypothetical protein plu3247 [Photorhabdus luminescens subsp. laumondii TTO1]
MKVNRHHQYGYFGYIFITLSLVGIFLMLIYLNKTLLEERGLLKSALYAYATVFPLLLIGLFSNAVWWHIR
QNKAQKKLRPETERTADRSSQSALVLSDLGDRMRLRYGRFWWYKVRILLVVGEVEQVEAIAPGLTTTHWL
EGYRTLLLWGGSLQAEPNTAQLMALRRLRRYRPLNAIVWALTENQSAQPVWMDKALRMLQKQAHQLRWQA
PVYLWQVCHSTWSQEGRITQTVGCFFPERCTPDIVATQLQTLVDPLRERGMQQLLEKTAHDFLCRLSANL
KQQGIAHWQQVLTPWLAEYGDVVSLRGLMFSLPLKAQTTRLPQIWLPDTAWQGVLEGSRCFHGRRVGMLH
TQTVCRGLIVLGLLWGAGMVLSFFTNRDQLAVVQAAVTDLKVQPENSDAQLMALKDLRNEVDRLQDRAEH
GVPWYERFGLSQNQKLLTAVLPDYAQVNNRLIRDKAAAVLHAKLSALVNLPPGSPLRAKWAQAGHDQLKA
YLMMAQPEKVDAVFLTRILDENEPERAGIAPAVWLDMAWDLWSFYAENLAAHPEWRITPDKALIKQVRQL
LLLQLGKHNAEAALYQQMLQSVEKNYSDLTLRQMTGDTDAARLFTTSHVIPGMFTRQAWEGGIQKAIAEA
VASRKEAIDWVLSDNRQAVSASVSPEELKARLTARYFTDFAGVWQDFLNSLRWNKTRNLSDVIDQLTLMA
DGRQSPLIALMNTLAYQGETGQQGPSLSDSLVKSAKTLLNKKTPRMINQQTAGLHGPMDETFGPLLALMG
ENQAEGRIKADSTLNLQTFLTRVTDVRLKLQQMNNSDDPPAMANALAKTVFEGKSTDLTDTQGYGRLIAA
SLGGQWRSFGQTLFVEPLAQAWQGVLKPATANLNSQWQTAIVDNWDRAFAGRYPFAGGDSEISLPMLGQF
IRSDSGRIEQFLTRQLGGILHKAGNQWVVDEVNGQGVQINPDFLKAINQLSQLSDLLFADGSQGLRFELR
ARAVRDVVETDLTIDGQKLRYFNQMESWQSFRWPGETYKPGVMLTWTSVNAGARLFGDYQGNWGLIRWLA
QAKAERLDESRYRLIFTAPDGLPLTWILRTELGEGPLALLKLRGFKLPKNIFVVTPGNHTTISAVNDDDL
ITE
 
Nucleotide Sequence: 3372 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3847012-3843641 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAAAGTTAATCGTCACCACCAATATGGCTATTTTGGATATATTTTTATTACCCTTAGCCTTGTCGGGA
TATTTCTCATGTTGATCTACTTGAATAAAACATTACTTGAGGAACGGGGGCTGCTTAAATCCGCATTGTA
TGCCTACGCCACAGTTTTTCCGCTCTTATTAATAGGCTTATTTAGCAATGCTGTCTGGTGGCATATTCGG
CAGAATAAAGCGCAGAAAAAACTCAGACCTGAAACCGAGCGGACAGCGGATCGCTCCAGTCAGTCTGCTT
TGGTACTGAGTGACTTGGGCGATCGCATGCGCCTCCGTTACGGGCGGTTCTGGTGGTATAAAGTCCGCAT
TTTACTGGTGGTGGGCGAAGTGGAGCAGGTGGAAGCCATCGCGCCGGGGCTGACCACGACGCACTGGCTG
GAGGGTTATCGCACGCTATTGCTCTGGGGCGGCAGTTTGCAAGCGGAACCGAATACCGCTCAATTGATGG
CCCTGCGTCGCTTGCGCCGTTACCGCCCGCTCAATGCCATTGTCTGGGCGCTGACCGAAAACCAAAGTGC
GCAGCCGGTATGGATGGATAAGGCCCTGAGGATGTTGCAAAAACAGGCCCACCAGTTGCGCTGGCAGGCT
CCGGTCTACCTGTGGCAGGTGTGTCACAGTACCTGGTCTCAGGAAGGTCGTATCACTCAGACCGTCGGCT
GCTTTTTTCCTGAACGCTGTACCCCGGATATCGTGGCGACACAGTTACAAACGTTGGTTGACCCGTTGCG
CGAGCGCGGGATGCAGCAACTGTTGGAGAAGACGGCCCACGATTTTCTCTGTCGTCTGTCCGCGAACTTG
AAACAACAGGGGATTGCGCACTGGCAACAGGTCCTGACGCCGTGGTTAGCGGAGTATGGTGATGTGGTGT
CGCTGCGGGGTTTGATGTTCAGTTTGCCGCTTAAAGCGCAGACGACTCGCCTCCCGCAGATCTGGCTGCC
CGACACGGCATGGCAGGGGGTGTTGGAGGGCAGTCGTTGTTTCCACGGTCGGCGGGTGGGCATGCTCCAC
ACACAGACCGTTTGTCGTGGCCTGATAGTGCTGGGCTTGTTATGGGGTGCCGGAATGGTGCTCTCCTTTT
TCACCAACCGTGACCAGCTAGCCGTGGTGCAGGCGGCGGTAACTGACCTGAAAGTCCAGCCGGAGAATTC
TGATGCCCAGTTGATGGCCTTGAAGGATCTGCGTAACGAGGTGGACCGGCTGCAAGACCGGGCTGAACAC
GGCGTGCCGTGGTATGAGCGCTTTGGTTTGAGTCAGAATCAGAAACTGTTGACGGCGGTGCTGCCCGATT
ATGCGCAGGTTAATAACCGCCTGATACGGGACAAAGCCGCTGCGGTGTTGCATGCGAAACTGAGTGCGCT
GGTGAATTTACCGCCGGGCAGCCCTTTGCGGGCTAAGTGGGCGCAAGCCGGTCATGACCAGTTGAAAGCC
TACCTGATGATGGCGCAGCCGGAAAAAGTGGATGCTGTGTTTTTAACCCGGATACTGGATGAAAATGAAC
CCGAGCGGGCCGGTATTGCCCCCGCTGTCTGGCTGGATATGGCGTGGGATTTGTGGAGTTTTTATGCGGA
GAATCTGGCCGCGCATCCCGAATGGCGGATAACCCCGGATAAGGCGTTGATTAAACAGGTGCGTCAGTTG
TTGCTGCTCCAGCTAGGTAAGCACAATGCCGAAGCGGCGCTTTACCAGCAGATGCTGCAATCAGTGGAGA
AAAATTATTCGGACCTGACGTTAAGGCAGATGACCGGCGACACCGATGCGGCGCGGCTGTTTACCACCTC
TCACGTGATACCGGGGATGTTTACCCGTCAGGCGTGGGAAGGCGGGATACAAAAGGCGATAGCGGAGGCG
GTGGCGTCACGTAAAGAGGCAATTGACTGGGTGCTGAGTGATAACCGTCAGGCAGTCTCGGCTTCGGTAT
CGCCCGAAGAGCTGAAAGCCCGTTTGACCGCCCGTTACTTTACCGATTTTGCCGGGGTGTGGCAGGATTT
TCTCAACAGCCTGCGCTGGAACAAAACCCGTAACCTGTCGGATGTCATCGATCAGTTAACCCTGATGGCG
GATGGACGGCAGTCTCCGCTGATTGCGTTGATGAACACACTGGCCTATCAGGGCGAGACCGGGCAACAGG
GGCCGAGTTTATCGGACTCGTTGGTGAAATCCGCTAAAACGTTATTGAATAAAAAAACGCCGCGAATGAT
TAATCAACAGACGGCTGGCTTGCACGGGCCGATGGATGAAACCTTTGGGCCGTTGCTGGCGCTGATGGGA
GAAAATCAGGCAGAAGGAAGAATCAAGGCGGACAGTACCCTGAATTTACAAACCTTCCTGACGCGGGTAA
CCGATGTGCGTCTGAAACTGCAACAGATGAACAACAGCGACGACCCACCGGCAATGGCGAATGCGCTGGC
TAAAACGGTATTTGAAGGGAAAAGCACTGATTTGACCGATACTCAGGGTTATGGGCGCTTGATAGCCGCC
AGTCTGGGCGGCCAATGGCGGAGTTTTGGTCAGACGCTGTTTGTCGAGCCATTAGCGCAGGCGTGGCAGG
GAGTATTGAAACCGGCGACGGCGAATCTGAATAGCCAGTGGCAGACGGCGATAGTGGACAACTGGGATCG
GGCATTTGCGGGCCGTTATCCGTTTGCCGGTGGCGACAGTGAAATTTCATTGCCGATGTTGGGGCAATTT
ATCCGGTCAGATTCAGGGCGGATAGAGCAGTTTTTGACGCGTCAGTTAGGCGGGATACTGCATAAAGCGG
GTAACCAGTGGGTAGTGGATGAGGTGAATGGTCAGGGCGTACAGATTAACCCGGATTTTCTAAAGGCGAT
AAATCAGCTCAGTCAGTTATCGGACCTGTTGTTTGCGGATGGCAGTCAGGGATTGCGGTTTGAACTGCGG
GCCAGAGCGGTGCGGGATGTGGTGGAAACTGACCTGACGATAGATGGGCAGAAACTGCGTTATTTTAACC
AGATGGAAAGTTGGCAGAGCTTTCGCTGGCCGGGAGAGACCTATAAACCGGGTGTGATGCTGACGTGGAC
CAGTGTCAATGCCGGGGCGAGATTGTTTGGTGATTATCAGGGGAACTGGGGGCTGATCCGCTGGCTGGCA
CAGGCGAAAGCGGAGAGGCTGGATGAAAGCCGTTACCGACTAATATTTACCGCGCCGGATGGATTACCGT
TAACCTGGATTTTGCGCACAGAATTGGGCGAAGGGCCGCTGGCGTTATTAAAACTGCGCGGATTTAAATT
GCCGAAAAATATCTTTGTAGTGACGCCGGGTAATCACACGACAATATCAGCGGTAAATGACGATGATCTG
ATAACGGAATAG
 Primer design