SecReT6
Protein ID: 37528050
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4214
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4927191..4930550 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ7MZR3
KEGG IDplu:plu4214
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.00E-77, Aligned region: 398..710
DUF1215 [PF06744], Evalue: 2.50E-36, Aligned region: 833..954
ImcF-related_N [PF14331], Evalue: 0.0027, Aligned region: 156..208
ImcF-related_N [PF14331], Evalue: 0.0027, Aligned region: 445..459
ImcF-related_N [PF14331], Evalue: 0.0027, Aligned region: 663..678
Protein Sequence: 1119 a.a.     [Download]
>gi|37528050|ref|NP_931395.1| hypothetical protein plu4214 [Photorhabdus luminescens subsp. laumondii TTO1]
MFKAFITRNLGVGLVTSLIALVLGGLLSFWGDRFGLSTQAIKIIVWIISMVGVIWLLNLFRDYKQRLPVQ
EVAVKPPVEQAVLSEAPFYFQRLQYQLRRRYGPLWRRRVCILLVMGQREQVEAIAPGLTAQHWQEGEHHL
LLWGGGLQVQPDKAQLQALRQLRRRRPLDGVVWVMTEEQLGQRTQIETALRMLEKQGQQLGWQAPVYVWN
VRHSNWDQRDRPTQTVGCFLSEECTPESLAQSLHSLIPTLANRGMEQAIAENRHDFLLRLAQSLRDKGVT
RLVGQLTPLLERPPIRLSGVTFSLPLPVPSGMVEHGWLVDASWNGVLEQVRDSRGQAVGFPWEKSAQWGV
IALAALWGIGSVTSFGVNRHQIAVSRERLSAAGDRQGDVSARLLSQHGLQREIDRLQSQSARGTPWYSRF
GFNQNEALLKAMWPVYQRNNAELIRDAAARLLHQRLTELVNLPAGSAQRHQRITPAYNQLKVYLMMARPE
KADAAVMSRVLMADWPHRAGVTDGLWQNSGEALLTFYAENLPRHPEWKISVDNELVSEVRQILLNQLGQR
HGETMLYQKMLQQVAHSYRDLTLAQMTGATEASRLFSSRQVVPGMFTRQAWEGQVQKAIAQVVASRQEEI
DWVLSDGRQPISKAASPAELKARLTARYFTDFAGAWLNFLNSLRWHKTHNLSDTIDQLTLMADVRQSPLI
ALMDTLAYQGEAGQPGTALADSLVKSAQNLFQNNKPSVIDPTRLPPGPLDNAFGPLLALMGKSTEENGLT
ADPSLSLQTFLTRVTRVRLALQQLANTDDPPAVMEALAQSVFQGKSVELTDTRTYGSLIAASLGAEWNGF
GQAVFVQPLTEAWQTVLQPAAASLNAQWQSAVVADWQTDFDGRYPFVAAQNEVSLPMLGQFIRADSGRIE
QFLHNQLGGVLHKEGKYWVVDKVNSQGLHVNPAFLTAINQLSQVADVLFANGSEGIRFELRAKPVGDVAE
TDLTIDSQQLRYFNQMERWQRLRWPGDGDNPGVALTWTGVNSGARLYGDYPGAWGFIRWLEAAQVQMVDE
SRYRLNFATPEGLALTWILRTEVGKGPLVLLKLRGFTLPKTIFEENTGNNLVESGINNNDDEEEYRQNR
 
Nucleotide Sequence: 3360 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4930550-4927191 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGTTTAAAGCTTTTATTACCCGCAATCTTGGGGTGGGTCTGGTCACCAGTTTGATCGCACTGGTGTTGG
GCGGATTGTTATCTTTCTGGGGCGATCGATTCGGGTTATCTACTCAGGCTATTAAAATAATTGTCTGGAT
TATCAGCATGGTGGGGGTGATATGGCTGTTGAATCTTTTTCGTGATTACAAACAGCGTCTGCCTGTACAG
GAAGTAGCGGTTAAACCGCCTGTAGAGCAAGCTGTACTTTCAGAAGCGCCATTTTATTTTCAACGGTTGC
AATATCAGCTTCGTCGGCGTTATGGCCCCCTTTGGCGTCGGCGGGTATGTATTTTGTTGGTGATGGGACA
ACGGGAACAAGTAGAAGCCATTGCCCCCGGGTTAACCGCCCAGCACTGGCAAGAAGGCGAGCACCACCTG
TTGCTGTGGGGCGGCGGTTTGCAGGTACAGCCGGATAAAGCGCAGTTACAGGCGTTGCGCCAATTGCGTC
GCCGTCGTCCGCTGGATGGCGTGGTGTGGGTGATGACCGAAGAGCAACTCGGCCAGCGAACGCAGATAGA
GACCGCGTTGCGCATGCTGGAGAAACAGGGACAACAGCTTGGCTGGCAGGCCCCGGTGTATGTGTGGAAT
GTGCGTCACAGCAACTGGGACCAGCGCGACCGGCCAACCCAGACCGTGGGCTGTTTTCTGTCAGAAGAGT
GTACGCCTGAGAGTCTGGCGCAGAGCCTGCACAGCCTGATACCCACGCTGGCGAACCGGGGCATGGAACA
GGCGATAGCGGAAAACCGTCACGATTTTCTGTTGCGACTGGCGCAGTCTTTGCGGGATAAGGGGGTAACA
CGTCTGGTCGGGCAGTTGACGCCGTTGTTAGAGCGGCCGCCGATAAGGCTGTCGGGCGTGACGTTCAGTT
TACCGCTGCCGGTGCCGTCAGGCATGGTGGAGCATGGCTGGCTGGTGGATGCCAGCTGGAATGGGGTGCT
GGAACAGGTGCGTGATAGCCGGGGACAGGCGGTGGGTTTTCCGTGGGAGAAAAGTGCGCAGTGGGGTGTG
ATAGCGCTGGCAGCGTTGTGGGGAATTGGCAGTGTGACCTCGTTTGGGGTTAACCGTCATCAGATAGCGG
TCAGCCGTGAACGCCTCAGCGCGGCCGGTGACCGTCAGGGAGATGTATCGGCCCGTTTGCTGAGTCAGCA
TGGGCTGCAACGGGAGATTGACCGGTTGCAGTCTCAGTCAGCGCGTGGCACGCCCTGGTACAGCCGTTTT
GGGTTCAATCAGAATGAAGCCTTGTTGAAAGCGATGTGGCCGGTGTATCAGCGCAACAATGCCGAACTGA
TACGTGATGCCGCTGCCCGGTTGCTCCATCAGCGCCTGACCGAACTGGTGAACCTGCCGGCGGGCAGTGC
ACAGCGTCATCAGCGTATCACACCGGCGTATAACCAGTTGAAAGTGTATCTGATGATGGCGCGGCCGGAG
AAAGCGGATGCGGCGGTGATGAGCCGGGTATTGATGGCGGACTGGCCGCACCGTGCCGGGGTGACGGACG
GTCTGTGGCAAAACAGCGGCGAGGCATTACTGACTTTTTATGCTGAGAATTTACCGCGCCACCCGGAGTG
GAAAATCAGCGTGGATAACGAACTGGTCAGTGAAGTGCGTCAGATATTGCTCAATCAGCTCGGGCAGCGT
CATGGGGAAACGATGCTGTACCAGAAAATGCTGCAACAGGTGGCCCACAGTTACCGGGATTTAACCCTGG
CGCAGATGACCGGGGCTACGGAGGCGAGTCGCTTGTTTAGCAGCCGTCAGGTGGTGCCGGGGATGTTTAC
CCGTCAGGCGTGGGAAGGTCAGGTGCAAAAAGCGATAGCGCAGGTGGTGGCGTCCCGACAGGAAGAAATT
GACTGGGTACTCAGTGACGGTCGTCAGCCAATATCGAAGGCGGCTTCACCGGCGGAGCTGAAAGCCCGGC
TGACAGCGCGTTATTTTACCGACTTTGCCGGGGCATGGCTGAACTTCCTTAATAGCCTGCGCTGGCATAA
AACCCATAACCTGTCCGACACCATCGACCAGTTAACCCTGATGGCGGATGTACGCCAGTCCCCGTTGATT
GCCCTGATGGATACGCTGGCTTATCAGGGAGAAGCCGGGCAACCGGGCACGGCGTTGGCGGATTCGCTGG
TGAAATCGGCACAAAACCTGTTCCAGAACAATAAACCGTCAGTGATTGACCCGACCCGCCTTCCACCGGG
GCCACTGGATAACGCGTTTGGCCCGTTATTGGCGCTGATGGGCAAAAGCACAGAGGAAAACGGGCTGACG
GCGGACCCGTCACTGAGTCTGCAAACCTTCCTGACGCGGGTGACACGGGTGCGTCTGGCGCTGCAACAAC
TGGCGAATACCGATGACCCCCCGGCGGTGATGGAAGCGCTGGCACAGAGTGTATTTCAGGGGAAAAGCGT
GGAACTGACGGACACGCGGACCTATGGCAGCCTGATAGCGGCGAGTCTGGGAGCGGAATGGAACGGGTTT
GGTCAGGCGGTGTTTGTGCAACCGTTAACCGAGGCGTGGCAGACGGTGTTACAGCCGGCGGCGGCCAGTC
TGAATGCGCAATGGCAGTCGGCGGTAGTGGCGGACTGGCAGACCGACTTTGACGGCCGTTATCCATTCGT
GGCGGCGCAAAATGAGGTCTCTCTGCCGATGCTGGGGCAGTTTATTCGGGCCGACAGCGGGCGGATAGAG
CAGTTTCTGCACAATCAGTTAGGCGGCGTGCTGCATAAAGAGGGCAAGTATTGGGTGGTGGATAAGGTGA
ACAGTCAGGGACTGCATGTTAACCCGGCCTTTTTAACCGCGATAAATCAACTGAGTCAGGTCGCGGATGT
GCTGTTTGCTAACGGCAGCGAGGGGATACGGTTTGAATTGCGGGCGAAACCGGTGGGTGATGTGGCGGAA
ACGGACCTGACGATAGATAGTCAGCAGTTGCGTTACTTTAACCAGATGGAGCGCTGGCAGCGTTTACGCT
GGCCGGGGGACGGGGATAATCCCGGGGTGGCGCTGACCTGGACCGGGGTGAATAGCGGTGCGCGGCTGTA
TGGCGACTATCCGGGGGCGTGGGGATTCATTCGCTGGCTGGAGGCGGCACAAGTGCAGATGGTGGATGAA
AGCCGTTACCGGCTGAACTTTGCCACGCCGGAGGGGTTAGCGCTGACCTGGATATTACGGACCGAAGTCG
GGAAAGGGCCGCTGGTGTTATTGAAACTGCGGGGTTTTACCCTGCCGAAAACGATTTTTGAGGAGAATAC
GGGAAATAACCTTGTTGAATCGGGGATAAATAACAATGACGACGAAGAAGAATATCGCCAGAATAGGTAA
 Primer design