SecReT6
Protein ID: 37676638
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0978
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1086740..1088575 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ7MDQ8
KEGG IDvvy:VVA0978
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.50E-57, Aligned region: 30..333
Phage_base_V [PF04717], Evalue: 3.00E-26, Aligned region: 377..469
Protein Sequence: 611 a.a.     [Download]
>gi|37676638|ref|NP_937034.1| hypothetical protein VVA0978 [Vibrio vulnificus YJ016]
MKKATQDNKFINISTPYGKDAIILNSFEYREEMSELFSLRVYAYFNGQKGELNQIMGQPVIIKMDNNSQV
MLEPRYFHGFVAKATLAGSRVTKFEDGENYKNIELVVVPKLNFADYKINSRIFQNKDIKEIISLILGEHG
VDFSFSLTKSYAKYNYKVQYEESDLQFVKRLLSEEGLSFCFSHTKSSHVIEIFDDASYYKPGAEFLIDFN
SGTAELGHISSWHEAQSMVIMRSHKSGYDMKKPASHPNNTAKGSESLFTVPSSEHYEYLGEAESGDQYKT
RNTHTIESLQQNAYVCSGESSCRSFTVGRSFKFGKHEDPSRIGKEFVLSSIVINAAVFNQVGHGGPSNQG
VRSYFTCIESGKVHRPAVNFVRPVIRGIQTAVVTGNKQGEIYVDKYGRIKVQFHWDREGKFDTTSSCWIR
VAQQIAGNGWGSSFLPRVGQEVIVEFINGDPDQPVVTGSLYNGTQAPPFSLPEKKTQSGYRSQSVEKGAS
NYNELRFEDKPGEEHVYLHAEKNFQMVVEDSADVLVENNKTQKITNNLTEEVGQNVSGKIGKNYSLDIGE
VLSLTAGKSIEIKVGGASIQMSSSGEINIKGNKIAINGASIALKAGQISLN
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1088575-1086740 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGAAAAAAGCGACTCAAGATAATAAATTTATAAATATTTCCACGCCTTATGGGAAAGATGCGATTATTC
TCAATTCTTTTGAATATAGAGAAGAAATGTCAGAGCTATTTTCATTGCGAGTTTATGCTTATTTTAATGG
TCAAAAAGGCGAATTGAATCAAATCATGGGTCAGCCAGTTATTATCAAAATGGATAATAATAGCCAAGTC
ATGTTGGAACCGAGATACTTCCATGGATTTGTTGCAAAGGCAACACTAGCAGGAAGCCGAGTGACCAAAT
TTGAAGATGGTGAAAACTACAAAAACATTGAGCTTGTTGTTGTGCCAAAATTGAATTTTGCGGACTACAA
AATCAACAGCCGAATCTTTCAAAATAAAGATATAAAAGAAATTATTTCATTAATTCTTGGTGAGCATGGC
GTCGACTTTTCTTTTTCTCTGACCAAAAGCTATGCCAAGTATAACTACAAAGTTCAGTACGAAGAATCGG
ATCTACAGTTTGTTAAAAGACTCTTATCTGAGGAAGGGCTGTCGTTCTGTTTCAGCCATACTAAATCTTC
ACATGTGATCGAGATATTTGATGATGCCAGCTATTACAAGCCAGGTGCTGAATTTTTAATTGATTTCAAT
TCAGGTACCGCAGAGTTGGGTCATATCTCTTCGTGGCATGAAGCTCAATCGATGGTGATCATGCGCAGTC
ACAAAAGTGGCTATGATATGAAAAAGCCAGCTTCACATCCCAACAATACGGCAAAAGGGAGCGAATCCTT
ATTTACCGTTCCGAGTAGCGAGCATTATGAATATCTGGGTGAAGCGGAGTCGGGTGATCAGTACAAAACG
AGAAATACCCACACGATCGAATCATTACAGCAAAACGCATACGTTTGTTCTGGAGAGTCGAGTTGCCGCT
CCTTTACTGTCGGCAGAAGTTTCAAATTTGGTAAGCATGAAGACCCTAGCCGAATCGGCAAAGAGTTCGT
GCTCTCATCGATTGTTATCAACGCAGCTGTTTTCAACCAAGTAGGTCATGGTGGCCCTTCAAATCAAGGT
GTTAGGAGTTATTTTACCTGCATTGAGTCAGGGAAAGTGCATCGTCCGGCGGTTAACTTTGTGAGGCCAG
TTATTCGCGGAATCCAAACTGCGGTTGTGACAGGTAATAAGCAAGGTGAAATCTACGTCGATAAATATGG
GCGGATAAAAGTTCAATTTCACTGGGATCGTGAAGGTAAGTTTGATACGACGAGCTCGTGCTGGATACGT
GTCGCACAACAAATTGCAGGGAATGGCTGGGGAAGCTCATTTCTGCCAAGAGTAGGGCAAGAGGTCATCG
TTGAATTTATCAATGGGGATCCGGATCAGCCAGTGGTGACAGGGTCGCTTTACAATGGGACTCAAGCGCC
ACCTTTTTCGTTGCCAGAGAAGAAAACCCAAAGTGGTTACCGTAGCCAGTCTGTAGAAAAAGGGGCGAGT
AACTACAACGAATTACGCTTTGAAGACAAACCGGGTGAGGAACATGTCTATCTTCATGCGGAAAAGAACT
TCCAAATGGTCGTCGAAGATTCCGCTGATGTCCTAGTTGAAAACAATAAGACCCAGAAAATTACCAACAA
CCTAACGGAGGAGGTTGGACAAAACGTCTCTGGGAAGATTGGGAAAAACTATTCACTCGATATTGGCGAA
GTCCTTTCTCTGACCGCAGGCAAAAGCATTGAAATTAAAGTGGGCGGCGCTTCGATTCAGATGTCGAGTT
CGGGGGAGATCAATATTAAAGGCAACAAAATAGCCATTAATGGTGCCTCGATTGCCTTAAAAGCTGGCCA
GATTTCACTGAACTAG
 Primer design