SecReT6
Protein ID: 37676639
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0979
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1088630..1089109 [-]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDQ7MDQ7
KEGG IDvvy:VVA0979
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-30, Aligned region: 6..134
Protein Sequence: 159 a.a.     [Download]
>gi|37676639|ref|NP_937035.1| hemolysin-coregulated protein [Vibrio vulnificus YJ016]
MQSNTYLKYADIKGEATAEQYKDMITLLSVDWSVGREISSYTGTAMDREASSTRLYDMTITKLQDKASPD
LFKEATIGKGKPAVFHITKQGEKIEEIMKIQLTDAMISNYAVSIQDDRPIETITISYTEMMMTVTPTDDK
NNTSAPLVYGYSGVKGQQM
 
Nucleotide Sequence: 480 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1089109-1088630 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGCAGTCAAATACCTACCTGAAATATGCTGATATTAAAGGTGAAGCTACCGCAGAACAGTACAAGGATA
TGATTACTCTTCTTTCAGTTGATTGGAGTGTAGGTCGTGAAATTTCTTCTTATACTGGTACCGCAATGGA
TCGTGAAGCAAGCTCTACTCGTCTTTACGATATGACCATTACCAAACTTCAAGACAAAGCATCCCCAGAT
CTGTTCAAAGAAGCCACGATTGGTAAGGGTAAACCCGCTGTATTCCATATCACTAAGCAGGGTGAAAAAA
TCGAAGAAATCATGAAAATTCAACTAACAGATGCCATGATTTCTAACTATGCAGTGTCAATTCAAGACGA
CCGTCCAATTGAAACAATCACCATTTCTTACACAGAGATGATGATGACGGTGACGCCTACTGATGACAAA
AACAACACATCTGCTCCGTTGGTATACGGTTACAGCGGTGTTAAAGGTCAACAAATGTAA
 Primer design