SecReT6
Protein ID: 37676641
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0981
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1091903..1092904 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ7MDQ5
KEGG IDvvy:VVA0981
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.40E-71, Aligned region: 19..319
Protein Sequence: 333 a.a.     [Download]
>gi|37676641|ref|NP_937037.1| hypothetical protein VVA0981 [Vibrio vulnificus YJ016]
MAIDGGRERAVMKSEDFLAEIESLPLFTAIHLIETHLLQADSHLGSDALPKNEKIQLTVSQRLGYEAREL
INVVSNSQSNKLTLQTNIIGLTGEQGVLPSHYSELVMQRARENDTAMKDFFDIFNHRLLSLYYRCWQSYQ
LPAQLRTQDKKSAASPIQTVLSSLTGNQDDEAIFFGGMFTSKRRSRAYIKSVIEFYTGCDVRLHEFKGRW
FDISEAEQTRLCSRDRPEGQHAQLGLGAMLGKQSWNMSSGFDVELIAKDPDSLAALLHTERLSETKHLMC
RMLGTSKRIRWTLTARRAQLPSANLAKGRGRLGKGSILMPSLSNANKQITITI
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1092904-1091903 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGGCCATCGATGGCGGGAGAGAGAGAGCTGTTATGAAAAGTGAAGATTTTCTCGCTGAGATTGAATCGC
TACCTCTCTTTACCGCGATACATTTGATCGAGACTCATCTACTGCAGGCAGATAGTCATCTGGGTTCTGA
TGCGTTACCAAAGAATGAAAAAATCCAGCTCACAGTCTCGCAACGTTTAGGTTATGAGGCGCGAGAGCTG
ATAAATGTCGTGTCAAATAGCCAGAGCAATAAATTAACCTTACAAACCAACATCATCGGTTTAACCGGTG
AGCAGGGGGTACTGCCGAGTCATTACAGCGAGCTGGTTATGCAAAGGGCGCGTGAAAATGACACGGCTAT
GAAGGATTTCTTCGACATTTTTAACCACAGACTGCTCTCTCTCTACTACCGGTGTTGGCAGTCATACCAA
TTGCCCGCACAACTGCGAACGCAAGATAAGAAATCAGCGGCGTCGCCCATTCAGACCGTCCTCTCCTCTC
TGACTGGCAACCAGGACGATGAAGCGATTTTCTTTGGCGGTATGTTTACGTCAAAGCGTCGAAGCCGTGC
ATACATCAAAAGCGTCATTGAGTTTTATACCGGATGTGATGTGCGTTTGCATGAGTTCAAAGGTCGCTGG
TTTGACATTAGTGAAGCAGAGCAAACTCGCCTTTGCAGCCGTGATAGGCCGGAAGGGCAGCACGCACAAC
TGGGATTGGGGGCCATGCTTGGTAAGCAAAGCTGGAACATGAGTTCTGGATTTGATGTCGAGTTGATTGC
AAAGGACCCTGATTCATTGGCGGCGTTGCTCCACACCGAACGATTGAGTGAGACCAAGCATTTGATGTGC
CGCATGTTGGGAACGAGTAAGCGTATTCGTTGGACTTTAACCGCTCGTAGAGCACAACTTCCTAGCGCTA
ACTTAGCAAAAGGAAGAGGTCGATTAGGCAAAGGCAGTATCTTAATGCCGAGCCTATCGAACGCAAATAA
ACAAATAACGATAACAATTTAA
 Primer design