SecReT6
Protein ID: 37676642
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0982
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1092868..1094694 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ7MDQ4
KEGG IDvvy:VVA0982
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-187, Aligned region: 5..608
Protein Sequence: 608 a.a.     [Download]
>gi|37676642|ref|NP_937038.1| hypothetical protein VVA0982 [Vibrio vulnificus YJ016]
MSEDFLKYYNRELAYLRHKGHEFGEQYPKIAARLRMNDEVVEDPHVSRLLEGCAFLSARIRQSLDNAFPQ
LTEALIGQLFPDFHAPIPSMSIVQLKGTTSSSSAFTVAKGERVTITAPGYQECDFKTCCATQVHPFDVTD
AQFENAPFSGTECRMELAAKSVLKLEIQSNNAELSLSTLDDSCLRFYLSGQRQAALQLYQQIFQSCIGLS
LVQGGRCKKELTPRHIRSLGFDDQIQAVPYSKRSFSGTRLLIEYLHFPEKFLFFELTDLDLSVLASEQGK
VEIWLYFAEGNDWLEKQVSVENIALGAVPVVNLYQAKMKPMRVQASEYEYQLHPEHCDPESSEVVSIDDV
TLRNWNKVFENLPPYYAGTHTHYQTQYDLFWLMRREDRNWAGGFDEPGREVFVSLVDRKHQLFAPDAKES
WLMSIDTWCCNRNLPAKIPFGGGLPLVTLPESQDNFSRVRCLTTPTETIRAEMDETTRWQFAKLITLDHF
CNQQGAETLKQILNLLAFRGSPETKALIDSIKGMSTKMTTGRVVQNGRVGFCHGSEITLTISDQILSREQ
IFLLGNVLSSYFSQFAEVNTFTRLLIKLSSTGALFHTWPSMAGERELL
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1094694-1092868 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGAGTGAAGATTTTCTGAAATACTACAATCGAGAACTCGCGTATTTGCGTCATAAAGGCCATGAATTTG
GGGAACAATACCCTAAGATTGCAGCTCGATTGCGAATGAATGATGAAGTCGTTGAAGACCCTCATGTCTC
AAGGCTTCTCGAAGGGTGTGCTTTTCTCTCTGCTCGTATACGACAAAGCTTGGATAACGCGTTTCCACAG
CTAACCGAAGCGTTAATTGGGCAGCTATTTCCCGATTTTCATGCCCCCATTCCGTCAATGTCGATTGTGC
AGTTGAAAGGAACGACCTCTTCGTCGTCGGCGTTTACGGTGGCCAAAGGAGAACGCGTCACGATCACGGC
ACCGGGATACCAAGAGTGTGACTTCAAAACATGCTGTGCCACACAAGTTCATCCTTTTGATGTCACTGAC
GCCCAGTTTGAAAATGCCCCTTTTAGCGGCACAGAATGTCGTATGGAGCTCGCTGCCAAGTCAGTGCTCA
AACTCGAAATTCAATCGAACAATGCTGAGTTGAGCCTATCCACTCTGGATGATTCATGCCTGCGATTCTA
TCTGAGTGGTCAACGACAAGCGGCTCTGCAGCTTTATCAACAAATTTTTCAATCCTGCATTGGCCTAAGC
TTGGTACAAGGAGGTCGATGCAAAAAAGAGCTCACGCCACGTCACATACGTTCATTGGGCTTCGACGACC
AAATACAGGCGGTTCCATACAGTAAGCGTAGCTTTTCTGGCACGCGTCTATTGATCGAGTACTTGCACTT
CCCCGAAAAATTTCTCTTTTTTGAGCTGACAGACTTAGATCTCTCAGTCCTCGCTAGCGAACAAGGGAAA
GTGGAAATCTGGCTCTATTTTGCAGAGGGCAACGACTGGTTGGAGAAACAAGTCTCTGTCGAAAATATCG
CCTTAGGAGCGGTTCCGGTTGTCAATCTTTATCAAGCGAAAATGAAGCCAATGAGGGTGCAAGCCTCTGA
ATATGAATATCAACTGCATCCAGAGCACTGCGATCCAGAGTCGAGTGAAGTGGTCAGTATAGATGACGTC
ACTTTAAGAAACTGGAATAAGGTCTTCGAAAACTTGCCCCCTTACTATGCGGGGACGCATACCCACTATC
AAACGCAATATGATCTGTTCTGGTTAATGCGTAGAGAAGATAGAAACTGGGCTGGTGGTTTTGATGAACC
CGGGCGGGAAGTGTTCGTATCACTGGTTGATCGTAAGCACCAATTGTTTGCCCCCGATGCGAAAGAAAGT
TGGTTGATGTCGATCGACACGTGGTGTTGCAATCGTAATCTCCCCGCCAAAATTCCGTTTGGTGGAGGGC
TTCCTTTGGTCACATTGCCCGAGAGTCAGGACAATTTTAGTCGCGTTCGTTGCTTGACCACGCCAACCGA
AACCATTCGCGCCGAAATGGATGAGACGACTCGATGGCAGTTTGCAAAACTGATTACATTGGATCATTTC
TGCAATCAACAAGGAGCGGAAACGCTTAAGCAAATCTTAAACTTGCTGGCTTTTAGAGGTTCGCCAGAAA
CCAAAGCATTGATCGATTCAATTAAAGGTATGTCGACAAAGATGACGACTGGGCGTGTGGTGCAAAATGG
TCGGGTCGGTTTTTGCCACGGCAGCGAAATCACCTTAACGATTTCCGATCAGATTTTGTCTCGAGAACAG
ATCTTTTTGTTAGGAAACGTGCTATCGAGTTACTTCTCACAATTCGCTGAAGTCAACACGTTCACACGGC
TACTGATTAAGCTCTCCTCCACTGGGGCGTTATTCCATACATGGCCATCGATGGCGGGAGAGAGAGAGCT
GTTATGA
 Primer design