SecReT6
Protein ID: 37676643
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0983
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1094691..1095164 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ7MDQ3
KEGG IDvvy:VVA0983
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.40E-21, Aligned region: 30..137
Protein Sequence: 157 a.a.     [Download]
>gi|37676643|ref|NP_937039.1| hypothetical protein VVA0983 [Vibrio vulnificus YJ016]
MSETGLVPSLMDKLTDSDPLSSIDRDFPLTRHALMDSLRRDLESLLNSRINWMTLSDELREIQTSILRYG
LPDFSSMPFSSADGQQVLCQRVKETIQQYEPRLNYVSVAIAEDKNPLDRILKLRIKATCMIDNNEQELVM
DSEVEPVSLGIKLSRAK
 
Nucleotide Sequence: 474 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1095164-1094691 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGAGTGAAACAGGTCTAGTCCCATCCCTCATGGATAAATTGACGGACAGTGATCCTCTGAGCAGCATTG
ATAGAGACTTTCCATTAACGCGACATGCGTTGATGGATTCACTCAGACGAGATCTTGAATCATTACTGAA
CAGCCGTATCAACTGGATGACGTTGTCAGATGAGCTACGTGAAATACAGACGTCTATCTTGCGATATGGT
TTGCCAGATTTCTCATCAATGCCATTTAGCAGCGCGGATGGGCAACAGGTTCTGTGCCAACGAGTGAAAG
AAACCATTCAACAGTATGAACCTAGGCTCAACTATGTGTCGGTCGCCATTGCAGAAGACAAAAATCCGTT
AGATCGAATTTTAAAACTCAGAATCAAGGCGACCTGCATGATTGATAATAACGAGCAGGAGTTGGTTATG
GATTCGGAAGTTGAGCCCGTCAGTCTAGGGATAAAACTGAGTAGAGCGAAATGA
 Primer design