SecReT6
Protein ID: 37676644
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0984
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1095161..1095964 [-]
Producthypothetical protein
NoteTagJ
UniProt IDQ7MDQ2
KEGG IDvvy:VVA0984
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.50E-37, Aligned region: 138..259
Protein Sequence: 267 a.a.     [Download]
>gi|37676644|ref|NP_937040.1| hypothetical protein VVA0984 [Vibrio vulnificus YJ016]
MSDWQDHLSRSELELAKQALIKEIKLAPKNATIRSKFIELLCIMGEFERADEQLMQSIKLFPEYLPGASQ
IRHLVKAAQARKDFFAGAASAQFIEGTEKLGETIVQFILAQKENNHEELISVCERAEQSRQALQFEINGV
RYDDVRDLDDRLGGFIELFSSVGNYFLVPMDHLHYLELKPATNMLETLWRPCEFDIQGLGEGEAHFPMTY
VDSESGNQKLGRETDWKNVLGTDHCIGQGQKMWLVGDNALALSQLERVALAVETTIE
 
Nucleotide Sequence: 804 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1095964-1095161 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGTCAGATTGGCAAGACCACCTCAGTCGAAGCGAGCTCGAACTCGCCAAACAAGCGCTGATTAAAGAAA
TCAAATTGGCGCCCAAAAACGCCACTATTCGCAGCAAGTTTATTGAACTGCTATGCATCATGGGCGAGTT
TGAGCGCGCGGATGAACAGTTAATGCAGTCCATTAAGTTGTTCCCTGAGTATTTGCCCGGAGCAAGCCAA
ATTCGTCATCTGGTTAAAGCTGCTCAAGCAAGAAAGGACTTTTTTGCAGGCGCCGCATCAGCGCAATTCA
TAGAGGGTACCGAAAAACTGGGTGAAACGATTGTTCAGTTCATTTTGGCGCAAAAAGAGAACAACCATGA
GGAACTGATCTCGGTGTGTGAGCGTGCAGAGCAATCCCGTCAAGCACTCCAATTTGAAATTAATGGTGTG
CGCTATGATGATGTGAGAGATCTCGATGATCGATTGGGGGGCTTCATTGAGCTCTTTTCTTCCGTAGGTA
ACTATTTCTTAGTTCCGATGGACCATCTCCATTACTTGGAACTCAAACCCGCCACCAACATGTTGGAAAC
ACTATGGCGACCATGCGAGTTCGATATTCAAGGACTTGGCGAAGGTGAAGCTCATTTCCCAATGACGTAC
GTAGATTCCGAAAGTGGCAACCAAAAACTGGGCAGAGAAACGGACTGGAAAAATGTTCTAGGTACGGATC
ACTGCATCGGTCAAGGGCAAAAGATGTGGCTGGTTGGTGACAATGCGCTGGCTTTGAGCCAATTAGAACG
AGTCGCCTTGGCTGTGGAAACCACGATTGAATGA
 Primer design