SecReT6
Protein ID: 37676645
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0985
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1095975..1097582 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ7MDQ1
KEGG IDvvy:VVA0985
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-164, Aligned region: 98..529
Protein Sequence: 535 a.a.     [Download]
>gi|37676645|ref|NP_937041.1| hypothetical protein VVA0985 [Vibrio vulnificus YJ016]
MAANGRAYNVSPFGSENPSVWRIREARDWHNKPVPHIDMNFIEIEQLSHDLPTPESALENGIWMAHFLDA
KTMTQMVSYWVEISGAKTKQEFVHSIISAIESIDREVSAQLDEILHHRQMQKLEATWRGLNYLVQQKDHN
AGDLVKVKVLSCTWEELKKDSERAIEFDQSALFKLVYQNEYSMPGGEPFGLLIGDYYLCGGQNAMVVERE
INILRKIAQSAAAAFSPFIMSVEPSVFGSDYFENIASMTNVYAQFEQNEYVSWKRLRAEEDVRFIGLTLP
NLLYRQPYQSDGSRSDSFVYNERVRDSHQDLLWGNAAYSFAAVIVRAFQEHGWFTHIRGHKTGDYSQGII
QPPSLCQVDLPGKGGRYRAPLNLKITEKREQELADCGFIPLSPVAETPFVSFTSNISLHKPQQFASKGAS
VNARLSSMLQYTLCVSRIAHYLKVMGRDRIGSYQDAQSIERDFQAWLHKYTTASDEASDELRAKYPLNEA
KIKVTEKLGSPGKYYSVIHLRPHFQLDQMVSSIKLITELSPEHIV
 
Nucleotide Sequence: 1608 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1097582-1095975 Vibrio vulnificus YJ016 chromosome II, complete sequence
TTGGCTGCAAATGGAAGAGCTTACAACGTCTCTCCGTTTGGTAGCGAAAATCCCTCAGTCTGGCGGATAA
GAGAGGCTAGGGACTGGCATAACAAGCCAGTCCCTCATATTGATATGAATTTCATCGAAATTGAGCAACT
TTCCCACGATTTACCGACACCAGAGTCTGCTTTGGAGAATGGTATTTGGATGGCGCATTTTCTTGATGCA
AAGACGATGACGCAGATGGTGAGCTATTGGGTTGAGATTTCTGGAGCGAAAACGAAACAAGAGTTTGTTC
ACAGCATCATCAGTGCCATTGAATCGATTGATAGGGAAGTGAGCGCTCAACTGGATGAGATTCTACATCA
CCGACAAATGCAAAAGCTTGAAGCGACGTGGCGAGGCTTAAATTACCTTGTACAGCAGAAAGATCACAAT
GCTGGGGATCTCGTAAAGGTTAAAGTTTTGTCTTGTACGTGGGAAGAGCTGAAGAAAGACAGCGAGCGTG
CGATAGAGTTCGATCAATCCGCACTGTTTAAATTGGTCTATCAAAACGAATACTCGATGCCAGGGGGAGA
GCCGTTTGGTTTATTGATTGGTGACTATTATCTCTGTGGTGGTCAAAACGCCATGGTGGTTGAAAGAGAA
ATCAACATATTAAGGAAAATTGCGCAGTCGGCAGCAGCGGCGTTTAGCCCTTTCATTATGTCGGTCGAAC
CGAGTGTTTTTGGTTCAGATTACTTTGAAAACATCGCGTCGATGACGAACGTCTACGCCCAGTTTGAGCA
AAACGAATACGTGAGTTGGAAACGACTACGAGCCGAAGAGGATGTTCGGTTTATTGGTTTAACGCTACCC
AACCTTTTGTATCGTCAGCCATATCAAAGTGACGGCTCGAGATCGGATTCTTTTGTTTATAACGAACGAG
TTCGAGATTCGCACCAAGATTTGTTGTGGGGAAATGCCGCCTATTCCTTTGCGGCGGTCATTGTTAGAGC
ATTTCAAGAGCATGGTTGGTTTACACACATACGTGGACATAAAACAGGGGACTACTCTCAAGGCATTATC
CAGCCTCCTTCTTTATGTCAGGTTGATTTACCAGGAAAGGGAGGGCGATATCGCGCACCTCTCAACTTAA
AAATAACGGAAAAAAGAGAGCAAGAGTTGGCAGATTGCGGATTTATCCCTCTGTCTCCCGTCGCTGAAAC
GCCGTTTGTTAGCTTTACGTCGAACATCTCTTTGCACAAACCTCAGCAGTTTGCTTCCAAGGGAGCGAGT
GTAAATGCACGTTTGTCTTCGATGTTGCAATACACCTTATGTGTTTCAAGAATTGCTCACTATTTAAAAG
TGATGGGAAGAGATCGGATTGGCAGCTATCAAGATGCCCAATCGATAGAACGAGATTTTCAGGCGTGGCT
TCATAAATATACCACTGCGTCTGATGAGGCTTCGGATGAACTGAGAGCAAAATATCCGCTTAACGAAGCC
AAAATAAAAGTCACTGAAAAGCTAGGTAGCCCAGGAAAATATTATTCGGTGATCCACCTACGGCCCCATT
TTCAACTGGATCAAATGGTTTCATCGATCAAGTTGATTACGGAGTTGTCTCCTGAGCATATTGTATAA
 Primer design

Protein ID: 37676646
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0986
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1097513..1099006 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ7MDQ0
KEGG IDvvy:VVA0986
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-188, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|37676646|ref|NP_937042.1| hypothetical protein VVA0986 [Vibrio vulnificus YJ016]
MTTQLETQLDPTVEGQSFSFLEQAIGATKQTEASRAEELIKTLTEEALKGTVTWNKNLTVTFREAITALD
KKISEQLSAVMHHPELQKLEGTWRGLNYLVMNSETSSTLKIRMVSMTKKELHKDLSKAVEFDQSQVFKKV
YESEFGSAGGEPYGAIIGDYEFTNHPEDIETLRLMSNVAAAGFSPFLSAASPALFGFDEWTELSKPRDLE
KVFESLEYTQWRAFRESQDSRFVSLTMPKVLARLPYGQATSPVEEFGFEEFSVDETTGIAVNAQHNDYCW
MNSSYVLGAKLTDAFAKYGFCTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRRESELGKLG
FLPLCHYKNTNYAVFFGAQTCQKPAKYDSPDATANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVREVPGAPGAYNAVAWLKPWLQMEELTTSLRLVA
KIPQSGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1099006-1097513 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGACAACACAGCTTGAAACCCAATTAGACCCCACCGTTGAAGGCCAGAGTTTTTCCTTCCTCGAACAAG
CGATTGGCGCGACCAAACAAACGGAAGCGTCGAGAGCAGAAGAGTTAATCAAAACATTAACAGAAGAAGC
TTTAAAAGGTACGGTAACGTGGAACAAAAACCTAACCGTGACGTTTCGTGAAGCCATTACCGCTTTGGAC
AAAAAGATTTCCGAACAGCTGTCTGCGGTGATGCATCACCCTGAGTTGCAAAAGTTGGAAGGAACGTGGC
GTGGGTTGAATTATCTGGTGATGAATTCGGAAACGAGCTCCACGTTAAAGATTCGTATGGTGAGTATGAC
CAAGAAAGAGCTGCACAAAGATTTAAGTAAAGCAGTGGAGTTCGATCAAAGCCAGGTCTTCAAGAAAGTC
TACGAATCAGAATTTGGTAGTGCTGGTGGTGAGCCATATGGTGCGATCATTGGTGACTATGAATTTACGA
ATCATCCAGAAGATATTGAAACGCTGCGTCTTATGTCGAATGTTGCGGCAGCTGGTTTTTCTCCATTCCT
TTCTGCCGCCTCACCTGCGTTGTTTGGTTTTGACGAATGGACGGAATTGTCGAAGCCTAGAGATTTAGAG
AAAGTATTTGAGTCGCTCGAGTACACTCAGTGGCGCGCATTCCGTGAAAGCCAAGACTCACGCTTTGTCA
GCTTGACGATGCCGAAAGTCCTTGCTCGACTTCCTTATGGACAAGCGACATCGCCAGTCGAAGAGTTTGG
TTTTGAAGAGTTTTCCGTAGACGAAACCACCGGAATTGCGGTGAATGCGCAGCACAACGACTACTGCTGG
ATGAACTCGTCGTATGTACTGGGAGCGAAGCTCACTGACGCATTTGCCAAGTATGGATTCTGCACGGCAA
TTCGTGGTGCTGAGGGTGGTGGTCGTGTCGACAATCTGCCAACGCACTTCTTTATGAGTGACGATGGCGA
TCCAGATATGAAATGCCCGACCGAAATTGGCATTACTGACCGTCGTGAATCCGAGTTAGGTAAACTGGGC
TTCCTGCCTTTATGTCACTATAAGAATACCAACTACGCCGTATTCTTTGGTGCGCAAACCTGCCAAAAAC
CAGCCAAATACGATTCGCCAGATGCCACAGCGAATGCTGCGATTTCTGCGCGCTTGCCTTACATGATGGC
GACCTCTCGTTTTGCGCATTATCTCAAGGTCATGGCGCGAGATAAGATTGGTAGCTTCATGGAAGCAGAA
GACGTTGAGTCATGGCTAAATCGATGGATCCTTGGCTACGTCAACGCGTCGGAAGGCGGTGGTCAAGAGA
TCCGTGCGAAATACCCGTTGGCGGATGCGCGAGTGCAGGTCAGAGAAGTTCCTGGCGCACCGGGTGCTTA
CAACGCTGTTGCGTGGCTTAAGCCTTGGCTGCAAATGGAAGAGCTTACAACGTCTCTCCGTTTGGTAGCG
AAAATCCCTCAGTCTGGCGGATAA
 Primer design