SecReT6
Protein ID: 37676647
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0987
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1099018..1099530 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ7MDP9
KEGG IDvvy:VVA0987
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-61, Aligned region: 8..162
Protein Sequence: 170 a.a.     [Download]
>gi|37676647|ref|NP_937043.1| hypothetical protein VVA0987 [Vibrio vulnificus YJ016]
MTSIHSKLSRVRKPRVHITYDVETEGTSLKKELPFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDV
LKKMSPSVEFKVKNTMVDDGTEFAVNLQFQSMKDFEPASIVRQVDPLRQLMDTRNKLRDLMTKVDRSEEL
ENVLEAVLNNTDNLSKLADELKLGQEEKAE
 
Nucleotide Sequence: 513 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1099530-1099018 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGACTAGTATCCACTCGAAATTATCGCGAGTACGGAAGCCACGTGTTCATATTACCTATGATGTTGAAA
CAGAAGGCACATCACTGAAGAAAGAACTTCCGTTTGTAGTGGGTGTGATGGGGGATTTTGCTGGCCAAAA
TACTGAAGCCCTCAAACCACTAAAAGACCGTCGTTTTATTCAAATTGATCGAGACAACTTTGATGATGTA
CTCAAGAAAATGAGTCCATCAGTGGAGTTTAAAGTGAAAAACACGATGGTGGATGACGGAACGGAATTTG
CGGTCAATCTGCAGTTCCAATCGATGAAGGATTTCGAACCCGCCTCGATTGTTAGACAAGTTGATCCGCT
TCGTCAATTGATGGACACACGCAATAAATTGCGCGACCTAATGACCAAAGTTGACCGTTCAGAAGAGCTA
GAAAACGTGCTTGAAGCGGTTTTGAACAACACCGACAACCTATCTAAATTGGCAGATGAACTCAAGTTAG
GCCAAGAAGAGAAAGCGGAGTAA
 Primer design