SecReT6
Protein ID: 37676648
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0988
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1099547..1100680 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ7MDP8
KEGG IDvvy:VVA0988
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.10E-20, Aligned region: 69..129
Protein Sequence: 377 a.a.     [Download]
>gi|37676648|ref|NP_937044.1| hypothetical protein VVA0988 [Vibrio vulnificus YJ016]
MSHHYEEFTWFEPALLPISDEQPAGVDPRSDITPQSLYYRLKDQRMQARNIERNAIIEEEPILNYANLWQ
VFLDEVPQALASQTKDLEYVAWLIEALTRLDGFKGMAVGYELATYYLENYWADLYPMPDEDGLETRISPI
IGLNGIDNEGTLIFPLSCIPMTEGLSEQPYAYWEYQQALDLERCDEDKKRVKRDQGVPELSDITQAVKSS
SSQFYQRLIEDLNRAISSFERFSQALDSACEEVTPSSYISRKLDAIHSAIMHLASDKMIKVSKETNSDEP
SHSASSHEGESDGRGQGEANFQLLAANMHSREQAIVQLQRVADFFRETEPHSPVSYTIEQVIRWCGMSLP
ELLAELISDGDAKKGYFRLVGIADKNE
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1100680-1099547 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGAGTCATCACTATGAGGAGTTCACTTGGTTTGAGCCGGCCTTACTGCCAATTTCTGACGAGCAGCCAG
CAGGTGTGGATCCAAGAAGTGATATTACGCCTCAGTCACTCTATTACCGACTGAAAGATCAGAGAATGCA
GGCGCGAAATATTGAGCGAAATGCCATTATTGAAGAAGAGCCGATTCTTAACTATGCCAACCTCTGGCAA
GTGTTTCTTGATGAAGTTCCGCAGGCACTGGCGTCACAAACCAAAGATCTCGAGTACGTGGCATGGCTTA
TCGAAGCGTTAACTCGCCTTGATGGTTTTAAAGGAATGGCAGTTGGCTATGAACTGGCCACCTACTACTT
AGAAAATTATTGGGCAGATCTGTATCCAATGCCGGATGAAGATGGCCTAGAAACAAGAATTTCGCCCATC
ATCGGCCTGAATGGCATCGATAATGAGGGGACGCTCATTTTTCCGTTATCGTGCATACCCATGACCGAAG
GGCTGTCAGAACAACCTTATGCGTATTGGGAGTATCAACAAGCTTTGGACTTGGAGCGCTGTGATGAGGA
CAAGAAGCGAGTCAAACGCGATCAGGGTGTCCCTGAGTTATCTGACATTACCCAAGCCGTCAAATCGTCG
AGCAGTCAGTTCTACCAAAGACTGATAGAGGATCTAAATAGAGCGATAAGTTCTTTTGAACGATTTTCAC
AGGCTTTGGATAGTGCGTGTGAAGAAGTCACCCCAAGTTCCTACATTTCTCGAAAATTAGATGCAATACA
CTCGGCAATTATGCATTTGGCGAGTGACAAAATGATCAAGGTTTCAAAAGAAACGAATTCAGATGAACCA
TCGCACTCTGCTTCTAGTCACGAAGGCGAGAGCGATGGACGAGGGCAGGGCGAAGCTAATTTTCAGTTAT
TGGCCGCTAACATGCACTCTCGTGAACAGGCCATAGTGCAGTTGCAACGAGTAGCTGATTTTTTTCGTGA
AACAGAACCACATTCACCCGTTTCATACACGATTGAACAAGTGATTCGATGGTGTGGAATGTCTTTGCCA
GAACTTCTGGCAGAGCTTATTTCCGATGGAGACGCCAAGAAAGGCTATTTCCGTTTGGTTGGCATAGCAG
ACAAAAATGAGTAA
 Primer design