SecReT6
Protein ID: 37676651
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0991
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1102162..1105686 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ7MDP5
KEGG IDvvy:VVA0991
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-89, Aligned region: 60..112
ImcF-related_N [PF14331], Evalue: 1.30E-89, Aligned region: 191..453
ImcF-related_N [PF14331], Evalue: 1.30E-89, Aligned region: 1028..1057
IcmF-related [PF06761], Evalue: 1.80E-81, Aligned region: 504..806
DUF1215 [PF06744], Evalue: 3.30E-36, Aligned region: 920..1036
Protein Sequence: 1174 a.a.     [Download]
>gi|37676651|ref|NP_937047.1| hypothetical protein VVA0991 [Vibrio vulnificus YJ016]
MQTMAKIKRLLGQKWLISLIGLGAISIFIWFVGPLIAIAGIEPLKSDFNRLLVIVVLVFIWGVTNVVRQQ
KERKEQDESIQSLLEVDALTDKEAAAEIDVMRERIEKAIQVVTKGGKRKSHLYQLPWYVLIGPPGTGKTT
ALKESGLEFPLSDSMGVDSVSGIGGTRNCDWWFTNKAVLIDTAGRYTTQDSQAHVDSKAWYGFLGLLKQY
RKQRPINGAIVTVSIASMLTQTRTERGMHARAIKNRLQELKNQLGMQFPIYVVLTKADLIAGFSEFFTEL
TKEEREQLLGFMFPPSTEDERGVISLFNKEFHDLLERLDRRMMQRLETEHDLDKRSLIFEFPKQLRCLQA
NLDEFLNDIFAQNKFEESSMIRGVFIVSSLQEGTPVDRIMSETSQGLGLGKPLLRLSSKESSSYFVKNLF
ENVIFKEQFLGTVNRHHQKQSGWIRKGVYCSCMALSGAAITLWMMSYQWNNQLIDETDRQVTVVNDLLAK
SGLDFENDLIPSINILNHIMRFPMGYRQQDDERDRVTSFGLFQGEKIGQSAKSAYHQALTNYYSSYVESV
LLSEMKNNEQHREYLYETLKTYLMLFNDDKFESEHVLGWFNYFFERQYPGELNEELREQLYAHTENFLSQ
ADRGLYINNDSVTAARLVLTEMSLSERAYQRMKLQFLKSHVPSFRLTDVLGARGVEQFERKSGKPLSMGI
SGFYTYNGFHSIFQLQLGRMVKALMEENWVYGDEIDAQNIDHDLALQGVRERYYRDYVYEWKTLLNDIQL
KAAPSLKLSLEQSMALAGSERPIESLLKAVQKEVALTKISLSNNEKAAAEVAGKVAKVKFSNTADKLDLY
RPEEGNTFDIALPGKEVEAEFDDLVRMTDQDFDDIHLALSGLKSYLADLSSSGNNQKVAYKSILNGTVTG
EVAASIEHAKQLLPAPFNNWLGELSEESVKLAEKGSRSHLNTLWVNKVLKPYERSIKGRYPFEPRAKTEV
TLKDFSRFFGYGGTLDAFFVEYLEPFVDTSRSVWRFEKEIGVSQETLAVFQRADRIRQSFFELDNTLKVD
FAMKPIYLDQHITSFVLEVGGQNLAYRHGPARVKNLSWPAKRSATRVVFTPPDSIREIAYTYEGEWGIFK
LLDQSLKARPQSRKDNIVMIDLKGNKVQLELIPKSTMNPFWSSDMESFRCPQTL
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1105686-1102162 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGCAAACAATGGCAAAGATTAAACGTTTATTGGGGCAAAAATGGCTGATTAGCTTGATCGGGCTTGGGG
CAATTTCTATTTTTATTTGGTTTGTCGGACCATTGATCGCGATAGCAGGCATAGAGCCACTGAAATCAGA
CTTTAACCGTTTGTTGGTTATTGTGGTTTTAGTCTTCATTTGGGGCGTGACGAATGTTGTCCGTCAACAG
AAGGAGCGAAAGGAACAAGATGAAAGCATCCAAAGCCTATTAGAGGTGGATGCCCTGACCGATAAAGAAG
CGGCGGCAGAAATAGACGTCATGCGCGAAAGAATTGAGAAGGCGATTCAAGTCGTGACGAAAGGTGGAAA
GCGTAAGAGTCATCTCTACCAGTTACCTTGGTATGTACTTATTGGTCCTCCTGGAACCGGTAAAACGACG
GCATTAAAAGAATCGGGTCTCGAGTTTCCTCTATCAGATTCAATGGGTGTTGACTCGGTTTCTGGTATTG
GCGGTACGAGAAATTGTGATTGGTGGTTTACCAATAAAGCGGTGTTGATTGATACGGCTGGCCGATACAC
CACGCAAGATAGCCAAGCTCATGTCGATTCAAAAGCATGGTATGGATTCTTAGGCTTATTGAAGCAATAC
CGTAAACAGCGTCCCATTAATGGTGCGATTGTTACCGTCAGCATCGCAAGTATGCTCACACAAACTCGCA
CCGAACGAGGCATGCATGCAAGAGCGATAAAAAATCGGCTACAAGAACTGAAAAATCAATTGGGTATGCA
GTTCCCAATCTATGTTGTGTTGACGAAGGCTGATCTCATTGCGGGTTTTAGTGAGTTTTTTACAGAACTG
ACCAAGGAAGAGCGGGAGCAGTTATTAGGCTTTATGTTTCCACCTTCAACAGAAGACGAGCGAGGCGTCA
TCTCTCTATTTAACAAAGAGTTTCATGACTTACTGGAGAGACTTGATCGCCGCATGATGCAAAGGCTTGA
AACGGAGCATGACCTTGACAAGCGATCTTTAATTTTTGAATTTCCAAAACAATTACGTTGTCTTCAAGCG
AATCTAGACGAGTTTCTGAACGACATTTTTGCCCAAAACAAGTTTGAAGAATCTTCAATGATTCGCGGCG
TCTTTATTGTGAGTTCATTGCAAGAAGGCACGCCGGTTGATCGTATCATGTCTGAAACATCCCAAGGGCT
GGGGTTGGGCAAACCTCTACTGCGGTTAAGTTCCAAAGAATCAAGCAGCTATTTTGTAAAAAACTTGTTT
GAAAACGTCATCTTTAAAGAGCAGTTTTTAGGGACGGTCAATCGTCATCATCAAAAGCAAAGTGGCTGGA
TTCGAAAAGGCGTCTACTGCTCGTGCATGGCACTGTCTGGGGCTGCGATCACACTGTGGATGATGAGTTA
TCAGTGGAACAATCAACTCATTGATGAAACGGATCGTCAAGTGACTGTGGTGAATGACTTACTTGCTAAG
TCTGGTCTGGACTTCGAAAATGACTTGATCCCCTCGATAAACATTCTCAATCACATCATGCGTTTCCCTA
TGGGTTATAGACAGCAAGATGACGAGAGAGATCGTGTGACATCGTTTGGTTTGTTTCAAGGTGAAAAAAT
TGGCCAATCAGCTAAGAGTGCTTATCACCAAGCACTGACAAATTACTATTCATCCTATGTTGAATCGGTA
CTTCTCAGTGAAATGAAGAACAATGAACAACACCGAGAATATTTGTACGAAACACTCAAAACATATTTGA
TGCTCTTCAACGATGACAAATTTGAGAGTGAACATGTTCTTGGTTGGTTCAATTATTTCTTTGAAAGGCA
GTATCCCGGTGAACTGAATGAAGAGTTAAGAGAGCAACTCTACGCTCATACCGAGAACTTTTTGTCGCAG
GCAGACAGAGGCTTATATATCAACAACGATTCAGTAACCGCTGCCAGATTGGTTCTAACAGAAATGTCGT
TGTCGGAAAGAGCCTACCAAAGAATGAAACTGCAGTTCCTTAAAAGTCATGTGCCTTCATTTCGTTTAAC
GGACGTTCTCGGGGCTAGGGGAGTTGAGCAGTTTGAGCGAAAAAGTGGCAAGCCATTATCGATGGGGATT
TCCGGTTTCTACACGTACAACGGTTTCCATAGCATCTTCCAATTGCAACTGGGTCGTATGGTAAAAGCCT
TGATGGAAGAAAACTGGGTGTATGGGGATGAGATTGACGCCCAAAACATCGACCATGATCTCGCTTTGCA
AGGTGTGAGAGAGCGCTACTATCGTGACTATGTCTACGAATGGAAGACACTGCTCAATGACATCCAACTC
AAAGCGGCACCAAGTTTGAAACTAAGTTTAGAGCAGAGTATGGCATTAGCGGGCTCTGAGCGACCAATTG
AATCGCTGCTTAAAGCGGTACAAAAAGAGGTGGCATTAACGAAAATTTCGCTAAGCAACAACGAAAAAGC
GGCAGCTGAAGTCGCTGGCAAAGTTGCCAAAGTGAAATTTTCAAATACGGCGGACAAACTTGATTTATAT
CGTCCGGAAGAGGGCAATACGTTTGATATTGCGCTTCCTGGAAAAGAAGTGGAAGCCGAGTTTGATGATC
TTGTTAGGATGACAGACCAAGACTTTGACGATATTCATCTCGCACTGAGCGGTTTAAAAAGTTATTTGGC
CGATCTCTCTAGCTCAGGAAACAATCAGAAAGTCGCCTACAAGAGCATCTTAAATGGCACTGTGACAGGA
GAAGTTGCCGCGTCAATTGAACATGCTAAACAGCTTTTACCCGCTCCGTTTAACAACTGGCTAGGTGAAC
TTTCCGAGGAATCGGTCAAGTTAGCGGAAAAAGGATCGCGATCTCACCTTAATACGCTATGGGTTAACAA
GGTTCTTAAACCTTATGAGCGCAGCATCAAAGGTAGGTATCCCTTTGAGCCAAGAGCGAAAACAGAAGTG
ACGTTAAAGGACTTCAGTCGATTCTTTGGCTATGGCGGAACACTTGATGCGTTCTTTGTCGAATACTTGG
AACCGTTTGTCGATACGTCGAGAAGTGTGTGGCGCTTCGAGAAGGAAATCGGTGTCAGTCAAGAAACACT
CGCCGTATTTCAACGCGCAGATCGCATCCGACAGTCATTTTTTGAACTCGACAATACATTAAAAGTCGAT
TTTGCAATGAAACCGATATACCTAGACCAACATATAACCAGCTTTGTACTGGAAGTTGGGGGGCAGAATC
TTGCATACCGACATGGGCCAGCAAGAGTAAAAAATCTCTCTTGGCCAGCGAAGCGTTCAGCAACAAGAGT
GGTTTTCACACCACCCGATTCGATTCGTGAAATTGCTTATACCTATGAGGGCGAATGGGGCATTTTTAAG
TTGCTTGATCAATCTCTGAAAGCAAGGCCGCAATCTCGCAAAGACAATATCGTCATGATTGATTTGAAAG
GCAACAAAGTTCAACTGGAATTGATTCCTAAAAGTACGATGAACCCATTTTGGTCGAGTGATATGGAGAG
TTTCCGATGTCCGCAAACGCTATAA
 Primer design