SecReT6
Protein ID: 37676652
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0992
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1105664..1106992 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ7MDP4
KEGG IDvvy:VVA0992
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-62, Aligned region: 50..255
OmpA [PF00691], Evalue: 2.90E-13, Aligned region: 77..99
OmpA [PF00691], Evalue: 2.90E-13, Aligned region: 323..421
Protein Sequence: 442 a.a.     [Download]
>gi|37676652|ref|NP_937048.1| hypothetical protein VVA0992 [Vibrio vulnificus YJ016]
MDETIVKPTPGRKKAPQSTPVASLESDNTVLFTQNSKETRETSIVAFGNNVLLAEANVIVSLLGQIRATA
THSDVKQLREAFVQKMRDYENRLRLQGANSKQIDIARYCLCCAIDEAVLNTEWGSQSVWGHNSLLSTFYS
NTQGGEQFFIHLDESLAEPNKHLDLLEVMYICMSLGFLGQFRVRENGIEQHRSLKNRVMDVLKSHGRDYS
PSLNDGALAKVLVGEQIAEKAPLWVVLSITAAVLASVYMYLSYSLNEKSDQTFSQLMNLVPSKEIENQSA
DYISSLAVANQIQRSLATEIEMGLLKVDALPDRVRITFQSNDLFESGSAELVAHIFPVVSKVARALEATN
GKILVVGHTDNNPIFTSKFPSNWHLSLARATALTDRLASAGKLSGRVIPEGMGDARPLVSNETVEGRSIN
RRVEIDLLVQTQSKMDANNGKD
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1106992-1105664 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGGACGAAACGATTGTAAAACCAACCCCTGGGCGTAAAAAAGCACCGCAGTCGACACCTGTTGCATCGC
TTGAAAGCGATAACACGGTTCTCTTTACGCAAAATAGTAAAGAAACGCGTGAAACGAGTATCGTCGCGTT
TGGCAATAACGTACTGCTGGCAGAAGCGAATGTCATTGTTTCCTTGCTTGGCCAAATTAGAGCGACGGCC
ACGCACAGTGATGTCAAACAGTTACGTGAAGCATTTGTGCAAAAAATGCGTGACTATGAAAACCGGTTGA
GATTACAAGGCGCAAATAGTAAGCAGATCGATATCGCACGCTACTGTTTATGTTGTGCTATCGATGAAGC
CGTCCTAAATACCGAATGGGGAAGTCAATCCGTTTGGGGACACAACTCGTTATTGTCGACATTCTATTCC
AATACTCAAGGCGGTGAGCAGTTCTTCATACATCTCGATGAAAGCCTTGCCGAACCCAATAAGCACTTAG
ATCTGCTAGAAGTCATGTATATCTGCATGAGCTTAGGTTTTTTGGGGCAATTTCGAGTTCGAGAAAATGG
AATCGAGCAACATCGTTCCTTAAAAAACCGCGTAATGGATGTCCTTAAATCGCACGGTCGGGACTACAGT
CCTTCACTCAACGATGGTGCGTTAGCCAAAGTATTGGTTGGTGAGCAGATCGCAGAAAAAGCACCATTGT
GGGTTGTTTTATCAATTACCGCAGCTGTGTTAGCCAGTGTGTACATGTACTTAAGTTATAGCCTAAACGA
AAAATCCGATCAGACCTTTAGTCAGTTAATGAACTTAGTGCCGAGCAAAGAGATAGAGAACCAGAGTGCG
GATTATATTTCATCTCTTGCCGTAGCAAATCAAATCCAACGTTCGTTGGCAACGGAAATAGAAATGGGTT
TACTAAAAGTCGATGCATTACCCGATAGAGTGCGTATTACTTTTCAGTCCAATGATCTGTTTGAATCGGG
CAGTGCGGAGCTTGTCGCGCATATATTCCCTGTGGTTTCGAAAGTGGCCAGAGCACTCGAGGCGACCAAT
GGAAAAATATTGGTTGTCGGGCATACCGATAATAACCCCATTTTTACCAGTAAATTCCCTTCTAACTGGC
ATTTATCTCTCGCCAGAGCGACAGCGCTTACCGATCGCTTAGCATCAGCAGGCAAATTGAGTGGGCGTGT
CATTCCTGAAGGAATGGGAGATGCGAGACCTTTGGTATCAAATGAAACCGTAGAAGGAAGAAGCATCAAC
CGTAGAGTCGAAATCGATCTCCTAGTTCAAACCCAATCAAAAATGGATGCAAACAATGGCAAAGATTAA
 Primer design