SecReT6
Protein ID: 37676653
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0993
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1107001..1108323 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ7MDP3
KEGG IDvvy:VVA0993
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-139, Aligned region: 19..438
Protein Sequence: 440 a.a.     [Download]
>gi|37676653|ref|NP_937049.1| hypothetical protein VVA0993 [Vibrio vulnificus YJ016]
MSVYSPIVWSEGMFLRPQHFQQQERALSHEYKGLTRLVGCYARGIESFSLDKEQLKEGVVSLTECVGIFS
DMTFVNIPIKEQLPEPLKIEPGIENTLVQLVIPAEKSQGQNVSHSETSMVTRYKVVDHTLTDSVSGDEEV
LQLAALKCELKATNDNLPGYVSLPLVKIRHVGSEGQVILDEEFVPPFLNVHHSSLLTRYLNNVLAMIKIR
ADAIASRLGQGKSASSSAVDFIMLQMLNRYEANLRHLSKGSELHPHELATALLSLIGELSTFSSKNKRVP
KLPEYQHSNLGPVFSEMNQILSQYLSVVLEQTATKMPLDIRQFGIRVTPLPDKSLLSLCQFVLAVKADVS
ADEIRKKLPGQIKVGPAENIRDLINNQINGIAVSPLNVVPRQMPYAAGYVYFELIKQGAYWARLNESGGM
AFHVSGNYPGLEMELWSINQ
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1108323-1107001 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGAGTGTTTATTCACCGATTGTTTGGAGTGAAGGGATGTTTCTGCGTCCTCAACACTTTCAGCAACAAG
AGCGAGCGTTGTCTCATGAATACAAAGGTCTAACGCGTTTAGTGGGTTGTTATGCCCGAGGAATTGAATC
GTTTTCTCTCGACAAAGAACAGTTGAAAGAAGGGGTTGTATCGCTAACTGAGTGTGTTGGAATTTTCTCC
GATATGACATTCGTTAACATACCTATTAAAGAGCAGCTTCCTGAGCCACTCAAAATTGAACCAGGGATTG
AAAATACTTTGGTTCAGCTTGTGATACCTGCAGAAAAATCCCAAGGCCAAAACGTTTCCCATTCCGAGAC
TTCAATGGTAACGCGCTATAAGGTGGTTGATCACACCTTAACCGATAGCGTGTCTGGTGATGAAGAAGTA
CTTCAACTCGCTGCGCTTAAGTGCGAGTTAAAGGCAACCAATGACAATTTGCCGGGCTATGTCTCTTTGC
CTCTGGTGAAAATTCGTCATGTTGGTAGCGAAGGTCAAGTCATTCTTGATGAAGAGTTCGTACCACCTTT
CCTTAATGTCCACCATAGTTCGCTGCTTACTCGTTATCTGAATAACGTTTTAGCCATGATCAAAATTAGG
GCAGATGCCATTGCAAGTCGTCTCGGACAAGGCAAGTCAGCGTCTTCCTCAGCAGTAGATTTCATTATGC
TACAGATGCTGAATCGTTATGAGGCTAACTTAAGACATTTATCAAAAGGGAGTGAGCTTCATCCGCATGA
GTTAGCGACGGCCTTATTGAGCTTAATTGGTGAGCTGTCCACTTTTTCGAGTAAAAATAAGCGAGTCCCT
AAGCTTCCCGAATACCAACACAGTAATTTGGGGCCTGTCTTTTCTGAGATGAATCAAATCCTCAGTCAAT
ATCTGAGTGTGGTATTGGAGCAAACTGCGACCAAGATGCCCTTGGATATTCGCCAGTTTGGGATTCGCGT
TACGCCATTACCAGATAAAAGTTTGCTTTCACTTTGTCAGTTTGTATTGGCCGTTAAAGCCGATGTCTCT
GCCGATGAAATTAGAAAAAAGTTACCAGGACAAATCAAAGTTGGACCAGCAGAGAATATTCGCGACCTTA
TCAATAATCAGATCAACGGTATTGCCGTTTCGCCACTGAATGTGGTGCCAAGACAGATGCCTTACGCAGC
AGGCTACGTCTATTTTGAGCTGATTAAACAAGGCGCTTATTGGGCTCGTTTAAATGAAAGCGGGGGAATG
GCATTTCATGTCTCTGGTAATTACCCAGGGTTAGAAATGGAGCTTTGGAGTATTAACCAATAA
 Primer design