SecReT6
Protein ID: 37676654
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0994
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1108347..1108802 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ7MDP2
KEGG IDvvy:VVA0994
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.70E-37, Aligned region: 14..147
Protein Sequence: 151 a.a.     [Download]
>gi|37676654|ref|NP_937050.1| hypothetical protein VVA0994 [Vibrio vulnificus YJ016]
MKAMAKIITTIIVFLLVGCSAANMVVSPYSNLEIKTGFNVNPDMNGRPSPVVVYVLELTSDTLFTSQDFF
SLYENTAQTLGPDLVNKTELYLSPGQKTLYESTMKPSVEYIGIVVAYRDIENANWRKVIKVDRKGYNTYE
LSLDELSLAIK
 
Nucleotide Sequence: 456 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1108802-1108347 Vibrio vulnificus YJ016 chromosome II, complete sequence
ATGAAAGCCATGGCAAAAATAATTACCACAATAATAGTATTTTTATTAGTGGGTTGCAGTGCGGCAAATA
TGGTTGTTTCTCCCTATTCAAATTTGGAAATAAAGACGGGGTTCAATGTCAATCCAGATATGAATGGCAG
ACCTTCACCTGTCGTAGTTTATGTCCTTGAACTCACTTCTGATACCTTATTTACGAGTCAAGACTTCTTC
TCTCTATATGAAAATACAGCCCAAACGCTAGGTCCGGATCTGGTGAACAAAACAGAATTGTATCTCTCCC
CAGGCCAAAAAACACTTTATGAATCTACGATGAAACCAAGTGTTGAATATATCGGCATTGTAGTGGCATA
TCGAGACATCGAAAATGCAAATTGGCGCAAGGTGATAAAGGTCGACCGCAAGGGCTATAACACCTACGAG
CTTTCACTAGATGAATTGTCTTTGGCTATAAAATAA
 Primer design