SecReT6
Protein ID: 37676655
SecReT6 ID54
T6SS typei5
Gene symbol-
Locus tagVVA0995
StrainVibrio vulnificus YJ016
Repliconchromosome II [GenBank: NC_005140] [Browse all T6SS(s) in this replicon]
Location [Strand]1108803..1110107 [-]
Producthypothetical protein
NoteFha
UniProt IDQ7MDP1
KEGG IDvvy:VVA0995
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.20E-16, Aligned region: 62..130
FHA [PF00498], Evalue: 3.20E-16, Aligned region: 407..424
Protein Sequence: 434 a.a.     [Download]
>gi|37676655|ref|NP_937051.1| hypothetical protein VVA0995 [Vibrio vulnificus YJ016]
MHSNTENEIEFAFWVLLINALLIKWLEDVMGIVLSITSFHRFTPEIKSVYSIPTNEEHFCMKFGRSESCD
WVLPDPERIISGVHGEITKFGNDYLLRDLSTNGIFVNKSVSPVGNGVEVALNDKDVINFGDYEIEVSFKN
SEKHNVTQSQIHTNTLSPREVNKEPVSGNDNFMDFGFDANLFLAEEEKQQQNLSPELGDLDDFLDAPILS
PHIEPTLKEERATDYPRDEKVAKRCERVDSDLNAFLEGAGIDLSLVPEQEREQWFNRLGRSYSLMLEGLM
QTLHNRAEFKQANKLNHTSFQKKENNPLKFSANLEDAIHNLYNRRSASFLSPEAAIQSAFNDIEAHEKAM
IEGVHGAVSGVLRLLEPNTISGHVSQSEKNGLTSIFSQLDKKRWKKYENIYFQIRNEIDIDEKGFYLEDF
SKSYESAIRKVGRE
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|37675660|ref|NC_005140.1|:c1110107-1108803 Vibrio vulnificus YJ016 chromosome II, complete sequence
GTGCATTCTAATACTGAAAACGAAATCGAGTTTGCATTTTGGGTTTTGTTGATAAATGCATTATTAATAA
AGTGGCTAGAGGATGTTATGGGAATAGTGCTTTCGATTACTAGTTTCCACCGTTTTACACCAGAAATAAA
AAGTGTGTATTCAATACCAACCAATGAAGAACACTTTTGTATGAAATTTGGTCGCTCTGAGAGCTGTGAT
TGGGTATTACCTGATCCTGAACGAATTATTTCTGGTGTTCATGGTGAAATAACTAAGTTTGGTAATGATT
ATCTACTTAGAGATCTCTCTACAAATGGTATTTTTGTTAATAAGTCAGTCAGCCCAGTAGGAAATGGTGT
CGAGGTGGCTTTAAATGACAAAGATGTGATTAATTTTGGAGATTATGAAATCGAAGTATCATTTAAAAAT
AGTGAAAAGCATAACGTAACCCAAAGCCAAATCCACACTAATACTCTGTCACCACGTGAAGTAAATAAAG
AGCCTGTCAGTGGTAATGATAATTTTATGGATTTTGGTTTTGACGCAAACCTATTTTTGGCAGAAGAAGA
AAAGCAGCAGCAAAATCTATCGCCAGAGCTAGGTGATTTGGATGACTTTCTTGACGCTCCCATATTAAGC
CCTCACATAGAGCCGACTTTGAAAGAAGAGAGAGCGACCGACTATCCTCGTGATGAGAAAGTGGCTAAGC
GATGTGAACGTGTTGACTCGGATTTGAATGCCTTTCTCGAGGGGGCTGGCATCGATTTAAGCTTAGTTCC
AGAACAGGAAAGAGAGCAATGGTTTAATCGATTAGGTCGCTCTTATTCTCTCATGTTAGAAGGCCTAATG
CAGACACTGCATAATCGTGCAGAATTTAAACAGGCGAACAAATTAAACCATACATCTTTTCAGAAAAAGG
AAAATAATCCTCTTAAGTTTTCGGCGAATTTAGAAGATGCAATTCACAATCTATATAACAGACGCAGTGC
GAGTTTTCTCTCACCGGAAGCTGCAATTCAATCTGCATTCAATGATATAGAAGCTCATGAAAAAGCAATG
ATAGAAGGTGTTCATGGTGCTGTATCTGGGGTGTTACGACTGCTTGAGCCGAATACCATATCTGGACATG
TGTCTCAAAGTGAAAAAAATGGATTGACATCAATATTTTCGCAACTCGATAAAAAACGATGGAAGAAGTA
TGAAAATATCTATTTTCAAATAAGAAATGAAATTGACATTGATGAGAAAGGGTTTTATTTGGAAGACTTT
TCCAAATCTTATGAATCGGCAATAAGAAAAGTAGGGAGAGAATAA
 Primer design