SecReT6
Protein ID: 377807407
SecReT6 ID515
T6SS typeN/A
Gene symbolimcF
Locus tagBYI23_C000150
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]24315..27806 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDG8MIP8
KEGG IDbyi:BYI23_C000150
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.00E-69, Aligned region: 404..722
DUF1215 [PF06744], Evalue: 4.00E-35, Aligned region: 845..970
Protein Sequence: 1163 a.a.     [Download]
>gi|377807407|ref|YP_004978599.1| ImcF domain-containing protein [Burkholderia sp. YI23]
MSGKRLAGYWVIVGAATVLASAAAYFFGDAINPSPTIRVLAVVLCGVILLCMEGLVRGALKWTMRSGDSK
KARYARDPNARIGSTSGPGQTPLATWDSLAKALRARHGRRWRYRRPWLLLDGDPALIDRLSPKSGTPGWT
ITDNAVLLWSRPLSDGQANSEWLRELAKLRRGCPLDAVVALVDGDEGAQALSYGLSDSIGYRIGRTAELL
NWATPVYVVSVDSIWPTSPNSAEVIGCEFGSEVEAGLVTQRLNQLRERLADLGIRRLGQDKRDRYGAELS
RSLDKRIRPLAEFIVRLSNSRPKLTRIRGAFFTSQLTVGIYADQNSFVSRNQSLWRYIGEDAKSVGGHRV
GLHPVNVCAVMASVVVATWGAGMAISGMTNAHQMVLTNAALSDLDHAPDASARLRALRALQERIGFYEYR
VKEHTPLLSRFGLNHDREVLNALWTPYARASRALLTAPVQQDIEARLVDLSQMPTTDLDDQVTKVAQDGQ
SALKTYLMMAEPQHADAAFMTPQLAQYWNIPANLTAGEKIDLSQHLLGFWAERLAAHPDWKIQPREDLIS
TGRQTLLAVIGVKNSEDTIYQGVLTAVGHKYPDQTLASLTAGTDTRGVFRTTVTVPGVFTRQAWEGSIEA
AIDDAARHNGVAGDWVLGNAGTSSKAQTPEALRAALRRRYFADYAERWQSFMNSLRCDAAPTLPAAISQL
KLIADARQSPMIALMKALEYQGGAGAQRDSLSDTLVGKAQSIFGKKDDTPQAAKPDPAGPLGASFGPVLR
LVAQSSANVSAGARSDLSLERFTERVTSLRLKLQQISDSPDSDEQAKQIAQSLFLGKGSELADTLAYAQL
IAASLGEEWAGMGAELFVRPVSQATQTVLQPAQASLNDAWQATIVANWNRSFAGRYPFANTSSDASLPEL
ARFLRPQAGLIDTFLALQLAGVLQLQGDQWVPVAGATGSGSAAREIDPAFLKAINTLQRIGGHLLAQGEP
SYRFELRPVPQPGITDTLLTIDAQKLHYYNQMETWSGMAWPTSDPQSAGTRLEWQTETAGTNQRFEFAGR
WAFVRMLERAHVEPIDTSTYQLTWQAKAQFEDTRYASKTADAADQDVMRTDVGKGPLELLALKGFVLPSR
IFVKRETPVKGAKLPDGPPPLPKAAIEAAKKAETPLPGARGTL
 
Nucleotide Sequence: 3492 bp     [Download]
>gi|377807392|ref|NC_016590.1|:24315-27806 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAGCGGTAAGAGGTTAGCTGGGTATTGGGTTATCGTCGGTGCGGCGACTGTGCTTGCTAGCGCGGCTG
CGTATTTCTTTGGCGATGCAATCAATCCGTCTCCGACAATACGCGTTTTGGCGGTCGTGCTCTGTGGCGT
CATTCTGCTTTGCATGGAGGGACTTGTTCGAGGCGCGCTCAAATGGACGATGCGTTCAGGCGATTCGAAG
AAGGCCCGGTATGCGCGTGACCCCAACGCGCGGATTGGATCGACGTCCGGGCCCGGACAAACTCCGCTCG
CGACTTGGGATAGCCTTGCAAAAGCCCTGCGGGCTCGACATGGACGGCGTTGGCGATATCGCCGCCCTTG
GCTGTTGCTTGACGGAGATCCTGCGCTCATTGACCGGCTATCGCCAAAATCTGGTACGCCGGGGTGGACA
ATTACCGACAATGCCGTCTTGCTCTGGAGTAGACCGTTGAGTGATGGGCAGGCCAATAGCGAATGGCTGC
GCGAGCTGGCCAAGCTTCGCCGTGGCTGTCCCTTGGATGCAGTCGTTGCGTTAGTCGATGGTGATGAAGG
CGCGCAAGCTCTGAGTTACGGTCTGTCTGATTCGATAGGGTATCGGATCGGGCGGACAGCCGAGTTGTTG
AATTGGGCTACGCCCGTTTATGTCGTCAGTGTCGACTCGATATGGCCCACGTCGCCGAACAGCGCGGAGG
TGATCGGTTGCGAGTTCGGTTCTGAAGTTGAGGCCGGATTGGTAACACAGCGGCTCAACCAACTGCGTGA
ACGTTTGGCGGATTTGGGCATCCGGCGCTTGGGACAAGACAAGCGCGATCGTTATGGAGCCGAGCTGTCG
CGGAGCCTCGATAAGCGGATTCGACCGCTCGCTGAGTTTATTGTTCGCTTGAGCAATAGTCGGCCGAAGC
TGACTCGGATTCGCGGAGCTTTTTTCACATCTCAGCTGACCGTGGGCATCTACGCCGATCAAAATAGCTT
CGTTAGCCGAAATCAGTCATTGTGGCGTTACATCGGCGAAGACGCGAAATCGGTGGGTGGTCATCGTGTT
GGCTTGCACCCAGTGAACGTTTGTGCAGTCATGGCTTCTGTCGTCGTGGCGACGTGGGGCGCAGGCATGG
CGATATCGGGCATGACCAATGCCCACCAGATGGTGCTCACGAACGCGGCGTTGAGCGACCTCGATCACGC
GCCCGACGCATCGGCGCGTCTGCGCGCTCTGCGTGCACTACAAGAACGCATCGGCTTCTACGAATACCGC
GTGAAGGAACACACGCCGCTGCTCTCGCGCTTCGGGCTCAACCACGACCGCGAAGTGCTCAACGCCCTGT
GGACGCCCTACGCCCGTGCCAGCCGTGCGCTGCTGACTGCACCCGTGCAGCAAGACATCGAAGCCCGCCT
GGTCGATCTGAGCCAGATGCCGACCACCGATCTCGACGATCAGGTCACCAAAGTCGCCCAAGACGGTCAG
AGCGCGCTCAAGACGTACCTGATGATGGCCGAACCGCAGCACGCCGACGCGGCTTTCATGACGCCACAAC
TGGCCCAGTACTGGAACATCCCCGCCAATCTCACCGCTGGCGAGAAGATAGACCTTTCGCAGCATCTGCT
CGGTTTTTGGGCCGAACGCCTTGCCGCGCATCCCGACTGGAAGATCCAGCCACGCGAGGATCTGATCTCC
ACGGGCCGTCAAACCTTGCTGGCGGTGATCGGCGTGAAGAACTCCGAGGACACGATCTATCAAGGCGTGC
TGACTGCAGTCGGCCACAAGTACCCCGATCAGACGCTCGCTTCACTCACCGCCGGCACCGATACACGTGG
CGTGTTCCGCACGACCGTCACGGTGCCGGGCGTGTTCACGCGCCAGGCGTGGGAAGGCTCGATCGAAGCC
GCGATCGATGATGCCGCCAGGCACAACGGCGTCGCGGGCGACTGGGTGCTGGGCAATGCCGGAACGAGCA
GCAAGGCGCAAACGCCCGAAGCTTTGCGCGCGGCCTTGCGCAGGCGCTACTTTGCCGACTACGCCGAGCG
CTGGCAGTCCTTCATGAACAGCCTCCGATGCGACGCCGCCCCGACGCTGCCCGCGGCAATCAGCCAACTG
AAGCTGATTGCCGACGCACGCCAGTCGCCGATGATCGCCTTAATGAAGGCGCTCGAATACCAAGGCGGCG
CAGGCGCACAGCGGGACTCACTCTCCGACACGCTGGTCGGCAAAGCGCAAAGCATCTTCGGCAAGAAGGA
CGACACGCCGCAAGCCGCCAAGCCCGATCCGGCAGGCCCGCTGGGTGCATCGTTCGGACCGGTGCTGCGA
CTCGTTGCGCAATCGAGCGCAAACGTTTCCGCAGGCGCGCGCAGCGACCTGAGCCTGGAGCGCTTCACCG
AACGCGTAACCTCATTGCGTCTGAAGCTGCAGCAAATCAGCGACAGTCCCGATTCGGACGAGCAGGCCAA
ACAAATCGCGCAATCGCTCTTCCTGGGCAAGGGCTCGGAACTCGCGGACACGCTCGCGTATGCCCAACTC
ATCGCGGCAAGTCTCGGCGAAGAATGGGCGGGCATGGGCGCGGAATTGTTCGTGCGGCCCGTGTCTCAAG
CCACGCAGACCGTGCTGCAACCGGCGCAGGCGAGCCTGAACGATGCATGGCAGGCGACCATCGTCGCCAA
CTGGAACCGCTCGTTCGCGGGCCGCTATCCGTTCGCTAACACGTCCAGTGACGCCTCGCTGCCGGAACTC
GCTCGTTTCCTGCGCCCGCAAGCCGGTCTGATCGATACGTTCCTCGCCCTGCAACTGGCAGGCGTGCTGC
AGTTGCAGGGCGACCAATGGGTGCCAGTGGCCGGCGCGACGGGCTCAGGCAGCGCGGCACGCGAGATCGA
TCCGGCATTCCTCAAAGCGATCAACACGCTGCAGCGCATCGGCGGTCATTTGCTCGCGCAGGGCGAACCG
TCGTACCGGTTCGAGCTCAGGCCCGTGCCGCAACCGGGCATCACGGACACGCTGTTGACCATCGACGCGC
AAAAGCTGCACTACTACAACCAGATGGAAACGTGGAGCGGCATGGCGTGGCCGACCAGCGATCCGCAGAG
CGCGGGCACGCGCCTCGAATGGCAGACCGAAACGGCGGGCACCAACCAGCGCTTCGAATTCGCCGGCCGC
TGGGCGTTCGTGCGCATGCTGGAACGCGCGCATGTGGAGCCGATCGATACGTCGACGTATCAGTTGACGT
GGCAGGCGAAGGCGCAGTTCGAGGACACGCGCTACGCCTCGAAGACGGCTGACGCCGCCGATCAGGACGT
GATGCGCACCGATGTAGGCAAGGGGCCGCTGGAACTGCTGGCCCTGAAGGGCTTCGTTTTGCCTTCGCGC
ATCTTCGTGAAGCGCGAAACACCGGTCAAAGGCGCGAAGCTTCCCGATGGTCCGCCGCCGCTGCCCAAGG
CCGCAATCGAAGCTGCGAAGAAAGCGGAAACACCGTTGCCCGGCGCACGAGGCACGTTGTGA
 Primer design