SecReT6
Protein ID: 377807577
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C001850
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]206730..207218 [-]
Producthcp protein
NoteTssD
UniProt IDG8MJC8
KEGG IDbyi:BYI23_C001850
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-42, Aligned region: 6..147
Protein Sequence: 162 a.a.     [Download]
>gi|377807577|ref|YP_004978769.1| hcp protein [Burkholderia sp. YI23]
MPMPCYLSLEGQNQGKIEGSTKVQGHEGKILVQAVDHTIEIPKSPQTGLPTGKRVHQAMTLTKEIDKSSP
KLFQALTSGEQMKDVTLEFYRISPKGTEEKYYTVKLSNAILTNMQSWTPNCLSPENKQMGHMEDVSFTYE
KITWTYEPDGIEAEDSWLAPKS
 
Nucleotide Sequence: 489 bp     [Download]
>gi|377807392|ref|NC_016590.1|:c207218-206730 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGCCGATGCCGTGCTACCTCTCGCTCGAAGGCCAGAACCAAGGGAAGATCGAAGGCTCGACCAAGGTTC
AGGGTCATGAAGGAAAGATCCTCGTTCAGGCCGTCGATCACACCATCGAAATTCCGAAGAGCCCGCAAAC
GGGCCTGCCCACCGGCAAGCGCGTGCATCAGGCGATGACGCTGACGAAGGAAATCGACAAATCGTCGCCC
AAGCTGTTTCAGGCGCTCACGTCCGGCGAGCAGATGAAGGATGTCACGCTGGAGTTTTATCGCATCTCGC
CGAAGGGTACGGAAGAGAAGTACTACACGGTGAAGCTGTCGAACGCGATTCTGACCAACATGCAGTCGTG
GACGCCGAATTGTCTGTCGCCCGAGAACAAGCAGATGGGGCACATGGAAGATGTGTCGTTCACGTACGAG
AAGATCACATGGACGTATGAGCCGGATGGGATCGAGGCCGAGGATTCGTGGTTGGCGCCGAAGTCTTGA
 Primer design

Protein ID: 377807581
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C001890
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]210293..210781 [+]
Producthcp protein
NoteTssD
UniProt IDG8MJD2
KEGG IDbyi:BYI23_C001890
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.70E-41, Aligned region: 6..146
Protein Sequence: 162 a.a.     [Download]
>gi|377807581|ref|YP_004978773.1| hcp protein [Burkholderia sp. YI23]
MPMPCYLTLEGQNQGKIEGSTKVQGHEGKILVQAVDHTIEIPKSPQTGLPTGKRVHLPMTLTKEIDKSSP
KLFQALTSGEQMKNVTLEFYRISPKGTEEKYYTVKLSNAILTNMKSWTPNCLSPENKQMGHMEDISFTYE
KITWTFDPDGIEAEDSWLAPKS
 
Nucleotide Sequence: 489 bp     [Download]
>gi|377807392|ref|NC_016590.1|:210293-210781 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGCCGATGCCGTGCTACCTCACTCTCGAAGGCCAGAACCAAGGCAAGATCGAAGGCTCGACCAAGGTTC
AGGGTCACGAAGGAAAGATTCTCGTCCAGGCCGTCGATCACACCATCGAAATTCCGAAGAGCCCGCAAAC
GGGCCTGCCCACCGGCAAGCGCGTGCATCTTCCGATGACGCTCACCAAGGAAATCGACAAGTCGTCGCCG
AAGCTGTTCCAGGCGCTCACGTCCGGCGAGCAGATGAAGAACGTCACGCTCGAGTTCTACCGCATCTCGC
CGAAGGGCACGGAAGAGAAGTACTACACCGTGAAGCTCTCGAACGCGATCCTGACCAACATGAAGTCGTG
GACGCCGAACTGCCTCTCGCCGGAGAACAAGCAGATGGGCCACATGGAAGACATCTCGTTCACCTACGAG
AAGATCACGTGGACCTTCGATCCGGACGGCATCGAAGCCGAAGATTCGTGGCTCGCGCCGAAGTCCTGA
 Primer design