SecReT6
Protein ID: 377807579
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C001870
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]208111..208605 [+]
Producthypothetical protein
NoteTssB
UniProt IDG8MJD0
KEGG IDbyi:BYI23_C001870
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.50E-53, Aligned region: 5..160
Protein Sequence: 164 a.a.     [Download]
>gi|377807579|ref|YP_004978771.1| hypothetical protein BYI23_C001870 [Burkholderia sp. YI23]
MASDGSVAPKERVNIVYRPATGDAKAEVELPLKLLVLGDFTLRDDDTPIEEMKPVNVDKDNFNEVLKGQK
LSLDLAVPNRLDANADPEAQIAMNLKFESVDDFSPDAIVEKVPELRQMIALRDALKALKGPLGNIPDFRK
RVQELIEDEGVRARLMSELGIEDK
 
Nucleotide Sequence: 495 bp     [Download]
>gi|377807392|ref|NC_016590.1|:208111-208605 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGGCATCTGACGGTTCAGTCGCTCCTAAGGAGCGGGTCAATATTGTGTATCGTCCGGCCACCGGAGATG
CCAAGGCGGAAGTCGAACTGCCGCTGAAATTGCTCGTGCTCGGCGACTTCACCTTGCGTGACGACGATAC
GCCGATCGAAGAAATGAAGCCGGTCAACGTCGACAAGGACAACTTCAACGAAGTGCTCAAGGGGCAAAAG
CTTTCGCTCGATCTCGCGGTGCCGAACCGCCTCGACGCGAACGCCGACCCGGAAGCGCAGATCGCGATGA
ACCTCAAGTTCGAGTCCGTCGACGATTTCTCGCCCGACGCGATCGTCGAGAAAGTGCCCGAGCTGCGCCA
GATGATCGCGCTGCGCGACGCGCTCAAGGCGCTCAAGGGACCGCTCGGCAACATCCCGGATTTCCGCAAG
CGCGTTCAGGAGCTGATCGAAGACGAAGGCGTGCGCGCGCGTCTGATGAGCGAACTCGGCATCGAGGACA
AGTGA
 Primer design