SecReT6
Protein ID: 377807580
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C001880
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]208607..210094 [+]
Producthypothetical protein
NoteTssC
UniProt IDG8MJD1
KEGG IDbyi:BYI23_C001880
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.70E-187, Aligned region: 68..493
Protein Sequence: 495 a.a.     [Download]
>gi|377807580|ref|YP_004978772.1| hypothetical protein BYI23_C001880 [Burkholderia sp. YI23]
MSDMEKQQETATAPASDANLSLLDSLIESARIKPGDEAYSITRQGIQAFISQLLEPQNAVERITQATVDS
MIADLDQKLCAQVDAILHHADFQKMESAWRSLKFLVDRTNFRENVKIQLLSVSKGKLLEDFEDAADITKS
GLYKNLYTAEYGQFGGQPFGAIVANYEFGPGTQDVKLLQNVASVSAMSHAPFIAAAGPHFFGVDTYDQLP
NLKDLSSIFEGPQFVKWNAFRESEDARYVGLTLPHFLLRVPYGADTVPAKKFNYKEDVSGGNSQFLWGNA
AFAFASRLTASFADYRWCANVIGPQGGGTVGDLPVYTYESMGELQNKIPTEVLISERREFELAEQGFIAL
TMRKNSDNAAFFSANSAQKPKFFGNTKEGKEAELNYKLSTQLPYMFVVSRLAHYIKVIQRENIGTWKERV
DLESELNTWIRQYVADMDNPAEGVRSRRPLRQAEIVVADVEGDPGWYRVDLKVRPHFKYMGASFTLSLVG
KLDKK
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|377807392|ref|NC_016590.1|:208607-210094 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAGCGACATGGAAAAGCAACAGGAAACCGCAACCGCGCCCGCGTCCGATGCGAATCTCTCGCTGCTCG
ACTCGCTGATCGAATCGGCGCGCATCAAGCCGGGCGACGAAGCGTATTCGATCACGCGTCAGGGCATCCA
GGCCTTCATTTCGCAACTGCTGGAGCCGCAAAACGCGGTCGAGCGCATCACGCAGGCGACGGTCGACAGC
ATGATCGCCGATCTCGACCAGAAGCTGTGCGCGCAGGTCGATGCGATCCTGCATCACGCCGACTTCCAGA
AGATGGAATCGGCATGGCGCTCGCTCAAGTTCCTCGTGGACCGCACGAACTTCCGCGAGAACGTCAAGAT
TCAATTGCTCAGCGTGAGCAAGGGCAAGCTGCTCGAAGACTTCGAAGACGCCGCGGACATCACCAAGTCG
GGTCTCTACAAGAATCTCTATACGGCTGAATACGGCCAGTTCGGCGGCCAGCCGTTCGGCGCGATCGTCG
CGAACTACGAGTTCGGTCCGGGCACGCAGGACGTGAAGCTGCTGCAGAACGTCGCGAGCGTGTCGGCGAT
GAGCCATGCGCCGTTCATCGCGGCGGCGGGCCCGCATTTCTTCGGCGTCGATACCTACGACCAGTTGCCG
AACCTGAAAGATCTGTCGTCGATTTTCGAAGGTCCGCAGTTCGTCAAGTGGAACGCGTTCCGCGAGTCGG
AAGACGCGCGCTACGTCGGTCTCACGCTGCCGCACTTCCTGCTGCGCGTGCCCTACGGCGCGGATACGGT
GCCCGCCAAGAAGTTCAACTACAAGGAAGACGTCTCGGGCGGCAACAGCCAGTTCCTGTGGGGCAACGCG
GCGTTCGCGTTCGCTTCGCGCCTGACCGCGAGCTTCGCCGATTACCGCTGGTGCGCCAACGTGATCGGGC
CGCAAGGCGGCGGCACGGTCGGCGATCTGCCGGTGTACACGTACGAATCGATGGGCGAGCTGCAAAACAA
GATCCCGACCGAGGTGCTCATCTCCGAGCGCCGCGAGTTCGAGCTTGCAGAGCAGGGCTTCATCGCGCTG
ACGATGCGCAAGAACAGCGACAACGCCGCGTTCTTCTCGGCGAACTCGGCGCAAAAGCCGAAGTTCTTCG
GCAACACGAAGGAAGGCAAGGAAGCCGAGCTCAACTACAAGCTTTCCACGCAGCTTCCGTACATGTTCGT
CGTGAGCCGTCTCGCGCATTACATCAAGGTGATTCAGCGCGAGAACATCGGCACGTGGAAAGAACGCGTC
GATCTCGAAAGCGAACTCAACACCTGGATTCGCCAGTACGTCGCGGACATGGACAACCCCGCCGAAGGCG
TGCGCAGCCGCCGCCCGCTGCGTCAGGCGGAGATCGTCGTGGCCGATGTCGAAGGCGATCCGGGCTGGTA
TCGCGTGGATCTGAAGGTGCGTCCGCACTTCAAGTACATGGGCGCGTCGTTCACGCTGTCTCTGGTTGGC
AAGCTGGACAAGAAGTAA
 Primer design