SecReT6
Protein ID: 377807582
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C001900
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]210877..211218 [+]
Producthypothetical protein
NoteTssE
UniProt IDG8MJD3
KEGG IDbyi:BYI23_C001900
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-18, Aligned region: 2..94
Protein Sequence: 113 a.a.     [Download]
>gi|377807582|ref|YP_004978774.1| hypothetical protein BYI23_C001900 [Burkholderia sp. YI23]
MDVLVNSVMTHLSRLLNTRQGSVQIDPQFGVPDFTNLAGTTAMGSTREIEEEIRRMVLRYEPRIKSPRVT
LNREETDVLSIRFALEGALEVDDREIPLRISTTVGANGRVSVG
 
Nucleotide Sequence: 342 bp     [Download]
>gi|377807392|ref|NC_016590.1|:210877-211218 Burkholderia sp. YI23 chromosome 3, complete sequence
GTGGATGTGCTCGTCAACTCGGTGATGACCCACCTGAGCCGGCTGCTCAACACGCGGCAAGGCAGCGTGC
AGATCGACCCGCAATTCGGCGTGCCCGATTTCACGAACCTTGCCGGCACCACCGCGATGGGTTCCACGCG
CGAGATCGAAGAGGAAATACGCCGCATGGTCTTGCGCTACGAACCGCGTATCAAGTCGCCGCGCGTGACC
CTCAATCGCGAGGAAACCGACGTGCTCTCGATCCGCTTCGCGCTCGAAGGCGCGCTCGAAGTGGACGATC
GCGAGATTCCGTTGCGCATATCGACGACCGTGGGCGCGAATGGCCGCGTCAGCGTCGGCTGA
 Primer design