SecReT6
Protein ID: 377807583
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C001910
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]211245..212969 [+]
Producthypothetical protein
NoteTssF
UniProt IDG8MJD4
KEGG IDbyi:BYI23_C001910
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-165, Aligned region: 2..574
Protein Sequence: 574 a.a.     [Download]
>gi|377807583|ref|YP_004978775.1| hypothetical protein BYI23_C001910 [Burkholderia sp. YI23]
MFNRYYQDELNKLKGLAGEFARANPAMAPMLSGTSADPDVERLLEGVAFLTGLTRQKLDDQFPEFVQELT
NLLFPHYLRPVPASTLVSFAAKGPRAQAARVAAGAELASVPVDGTSCRFRTTCDLDVEPLSIAEVNLLSH
AGAAPVLMIDFEMEGGASIAQWNGDSIRLFLSGGHVDASKLLLLLMNHVTDVRISSGGGERLSLGAKNLR
ASGFDADLLTYPSQALSGYRTIQEFFTQPEKFLFVDITGLKPWTAKAKGSSFSIVMTLDALHDWMPAIDG
NSFMLNVVPAINVFSHVADPITHDHRATEYRVNPEGRDRRHYQIYSVDQVLGYQQGRAQERLYQPFSMFR
HDGRGAQLSYRTTLKSANVERGSDVYLSLNYPPSETPLPETLSIRVTCTNRALPEGLKPGDINVPTSTSP
DQMSFTNIRAITPAQDPPAGEELLWCLLSHVSLNLLSLANADNLRKLLGLYVFNGRQGQELSNRRRIEGI
VDVTATRETRLVGRGGMQRGQSIRIRCREDHYAGIGDLYLFGCMLERFLGDYAGINAYTRVELEDTLSGT
VFKWPPRLGQQPML
 
Nucleotide Sequence: 1725 bp     [Download]
>gi|377807392|ref|NC_016590.1|:211245-212969 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGTTCAATCGATACTATCAGGATGAGCTGAACAAGCTGAAAGGCTTGGCCGGAGAGTTCGCACGCGCGA
ATCCCGCGATGGCGCCGATGCTCTCGGGCACGTCGGCCGATCCGGATGTCGAACGCCTGCTCGAAGGCGT
CGCGTTTCTCACGGGCCTCACGCGCCAGAAGCTCGACGACCAGTTTCCCGAGTTCGTTCAGGAACTCACC
AATCTGCTGTTTCCGCATTATCTGCGGCCCGTGCCGGCCTCGACGCTCGTGAGCTTTGCCGCGAAAGGCC
CGCGTGCGCAGGCGGCGCGCGTGGCCGCGGGCGCCGAGCTGGCATCGGTGCCGGTGGATGGCACGTCGTG
CCGCTTTCGCACGACATGCGATCTCGATGTCGAGCCGCTCTCCATCGCCGAAGTGAACCTGCTGAGTCAC
GCGGGCGCGGCGCCCGTGCTCATGATCGACTTCGAAATGGAAGGCGGCGCGAGCATCGCGCAATGGAACG
GCGACTCGATTCGCCTGTTTCTGAGCGGCGGCCATGTCGATGCATCGAAGCTGCTGTTGCTGCTGATGAA
TCACGTCACCGACGTGCGCATTTCGAGCGGCGGCGGCGAGCGTCTCTCGCTGGGCGCGAAGAATCTGCGC
GCGAGCGGCTTCGACGCCGATCTGCTCACGTATCCGAGCCAGGCGCTGTCCGGCTATCGCACGATCCAGG
AATTCTTCACGCAGCCGGAAAAGTTTCTCTTCGTGGATATCACGGGCCTCAAGCCCTGGACCGCGAAGGC
GAAGGGTTCGAGCTTCAGCATCGTGATGACGCTCGATGCGCTGCACGACTGGATGCCTGCGATCGACGGT
AACAGCTTCATGCTCAACGTCGTGCCCGCGATCAACGTGTTCTCGCATGTCGCCGATCCGATCACGCACG
ATCATCGCGCGACGGAATATCGCGTGAACCCCGAAGGCCGCGACCGTCGCCATTACCAGATTTATTCCGT
CGATCAGGTGCTCGGCTATCAGCAGGGCCGCGCGCAGGAACGCCTCTATCAGCCGTTTTCGATGTTCCGC
CACGACGGACGCGGCGCGCAACTGAGCTACCGCACGACGCTCAAGAGCGCGAACGTCGAACGCGGCAGCG
ACGTGTATCTGTCGCTCAACTATCCGCCCTCCGAGACGCCGCTGCCGGAAACGCTGTCGATCCGCGTCAC
CTGCACGAACCGCGCGTTGCCGGAAGGCCTGAAGCCGGGCGACATCAACGTGCCGACGAGCACGTCGCCG
GATCAGATGAGCTTCACCAATATCCGCGCGATCACGCCCGCGCAGGACCCGCCCGCGGGCGAGGAACTGC
TGTGGTGCCTGCTCTCGCATGTCTCGCTGAATCTGCTCTCGCTCGCGAACGCCGACAATCTGCGCAAGCT
GCTCGGCCTCTACGTCTTCAACGGGCGGCAAGGGCAGGAGCTGTCGAACCGGCGGCGCATCGAAGGCATC
GTCGATGTCACGGCCACGCGCGAAACGCGGCTCGTCGGGCGCGGCGGAATGCAGCGCGGCCAGTCGATCC
GCATCCGTTGCCGTGAGGACCATTACGCCGGAATCGGCGACCTGTATCTGTTCGGCTGCATGCTCGAACG
CTTCCTCGGCGATTACGCCGGCATCAATGCCTATACGCGCGTCGAGCTCGAAGACACGCTTTCCGGGACT
GTATTCAAATGGCCGCCGAGACTCGGGCAACAACCGATGCTGTAA
 Primer design