SecReT6
Protein ID: 377807584
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C001920
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]212933..213916 [+]
Producthypothetical protein
NoteTssG
UniProt IDG8MJD5
KEGG IDbyi:BYI23_C001920
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-76, Aligned region: 20..313
Protein Sequence: 327 a.a.     [Download]
>gi|377807584|ref|YP_004978776.1| hypothetical protein BYI23_C001920 [Burkholderia sp. YI23]
MAAETRATTDAVKALLLTNGEKYSYFQAIRLLRLYDRHTGLNQENLRVRPRLGLGFPENDIDRIEETAEG
GYRITANFFGLYGVASPLPTYYTEDLFEEEREGHHVTRDFLDIVHHAMYPLLFDAWAKYRVEQRIVEDRH
EASLNQLYAFVGLHDPDLRVDLLPGSAELLRYAGLFNQRPHSALGLKTLLADAFAPARVEVVCGVVRAVP
IPADQRWQLGQQPGRLGEDVWLGSEIDDHEGAIRIEFADLPHTLFHQMLPGGSAHARLSFFTRFYLTDPL
DVEVELRLRRDETGAARTGRGAWSRLGFDTWLNPGEAALPTRVKFAL
 
Nucleotide Sequence: 984 bp     [Download]
>gi|377807392|ref|NC_016590.1|:212933-213916 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGGCCGCCGAGACTCGGGCAACAACCGATGCTGTAAAGGCGCTGCTTCTCACCAATGGTGAGAAGTACT
CCTACTTCCAGGCGATCCGCCTGCTGCGTCTCTACGACCGGCACACGGGCCTGAATCAGGAGAACCTGCG
CGTGCGCCCGCGGCTCGGGCTCGGTTTTCCCGAGAACGATATCGACCGCATCGAGGAAACGGCGGAGGGC
GGCTATCGCATCACGGCGAATTTCTTCGGCCTGTACGGCGTGGCGTCGCCGCTGCCGACGTATTACACGG
AAGATCTTTTCGAGGAAGAGCGCGAAGGCCATCACGTCACGCGCGATTTTCTCGACATCGTGCATCACGC
GATGTATCCGCTGCTCTTCGATGCGTGGGCGAAGTACCGCGTCGAGCAGCGCATCGTCGAGGACCGGCAC
GAGGCGTCGCTCAATCAGTTGTATGCGTTCGTCGGGCTGCACGATCCCGATCTGCGCGTCGATCTGCTGC
CGGGCAGCGCCGAATTGCTGCGCTATGCGGGGTTGTTCAATCAGCGTCCGCATTCGGCGCTCGGCCTGAA
AACGCTGCTCGCCGATGCCTTCGCGCCCGCGCGAGTCGAGGTCGTGTGCGGCGTGGTGCGCGCGGTGCCG
ATTCCCGCCGATCAGCGCTGGCAGCTCGGGCAGCAGCCAGGCCGCCTCGGCGAAGACGTGTGGCTCGGCT
CGGAGATCGACGACCACGAAGGCGCGATTCGCATCGAATTCGCCGATCTTCCGCACACGCTTTTTCATCA
GATGCTGCCGGGCGGCAGCGCGCACGCGCGTCTGTCGTTTTTCACGCGTTTCTATCTGACCGATCCGCTC
GACGTGGAAGTGGAACTGCGCCTGCGCCGCGACGAAACCGGGGCCGCGCGTACGGGTCGCGGCGCGTGGT
CGCGGCTCGGTTTCGATACATGGCTTAACCCCGGCGAGGCGGCGTTGCCGACCCGGGTCAAATTCGCTCT
CTAA
 Primer design