SecReT6
Protein ID: 377807585
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C001930
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]213960..216602 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDG8MJD6
KEGG IDbyi:BYI23_C001930
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.20E-41, Aligned region: 225..245
AAA_2 [PF07724], Evalue: 5.20E-41, Aligned region: 611..776
AAA [PF00004], Evalue: 9.50E-19, Aligned region: 226..336
AAA [PF00004], Evalue: 9.50E-19, Aligned region: 616..737
AAA_16 [PF13191], Evalue: 5.10E-15, Aligned region: 202..241
AAA_16 [PF13191], Evalue: 5.10E-15, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 5.10E-15, Aligned region: 475..522
AAA_16 [PF13191], Evalue: 5.10E-15, Aligned region: 586..651
AAA_16 [PF13191], Evalue: 5.10E-15, Aligned region: 681..703
ClpB_D2-small [PF10431], Evalue: 4.40E-14, Aligned region: 782..853
AAA_5 [PF07728], Evalue: 3.30E-11, Aligned region: 227..242
AAA_5 [PF07728], Evalue: 3.30E-11, Aligned region: 323..355
AAA_5 [PF07728], Evalue: 3.30E-11, Aligned region: 615..731
AAA_22 [PF13401], Evalue: 2.80E-07, Aligned region: 224..311
AAA_22 [PF13401], Evalue: 2.80E-07, Aligned region: 342..385
AAA_22 [PF13401], Evalue: 2.80E-07, Aligned region: 490..530
AAA_22 [PF13401], Evalue: 2.80E-07, Aligned region: 614..634
AAA_22 [PF13401], Evalue: 2.80E-07, Aligned region: 677..709
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 220..246
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 613..636
Arch_ATPase [PF01637], Evalue: 0.00029, Aligned region: 203..239
Arch_ATPase [PF01637], Evalue: 0.00029, Aligned region: 278..377
Arch_ATPase [PF01637], Evalue: 0.00029, Aligned region: 612..636
Arch_ATPase [PF01637], Evalue: 0.00029, Aligned region: 686..698
Sigma54_activat [PF00158], Evalue: 0.00039, Aligned region: 222..239
Sigma54_activat [PF00158], Evalue: 0.00039, Aligned region: 588..737
AAA_25 [PF13481], Evalue: 0.00058, Aligned region: 226..288
AAA_25 [PF13481], Evalue: 0.00058, Aligned region: 436..507
AAA_25 [PF13481], Evalue: 0.00058, Aligned region: 611..633
IstB_IS21 [PF01695], Evalue: 0.00089, Aligned region: 219..247
IstB_IS21 [PF01695], Evalue: 0.00089, Aligned region: 615..642
AAA_14 [PF13173], Evalue: 0.0017, Aligned region: 231..328
AAA_14 [PF13173], Evalue: 0.0017, Aligned region: 614..696
AAA_14 [PF13173], Evalue: 0.0017, Aligned region: 830..854
Zeta_toxin [PF06414], Evalue: 0.003, Aligned region: 225..242
Zeta_toxin [PF06414], Evalue: 0.003, Aligned region: 614..656
RuvB_N [PF05496], Evalue: 0.004, Aligned region: 225..239
RuvB_N [PF05496], Evalue: 0.004, Aligned region: 282..305
RuvB_N [PF05496], Evalue: 0.004, Aligned region: 584..642
Clp_N [PF02861], Evalue: 0.0046, Aligned region: 27..73
Clp_N [PF02861], Evalue: 0.0046, Aligned region: 483..499
AAA_17 [PF13207], Evalue: 0.0052, Aligned region: 228..277
AAA_17 [PF13207], Evalue: 0.0052, Aligned region: 615..649
Protein Sequence: 880 a.a.     [Download]
>gi|377807585|ref|YP_004978777.1| type VI secretion ATPase, ClpV1 family [Burkholderia sp. YI23]
MLLVELKPLVGRLNGFCKQALEDGVGLCVSRGHYEITVEHMLVKLFGEQQADIALLLRQQDVEAALVQRS
INLSLEQMKTGNAGRPAFSPLLLELLQDAWLIASVDMQEPRIRSGAVLLAFLARPTYYATGEYAAPLRAL
NRETLLRSFDAVCGGSVEAATREAIGQNEGDASAPASGDGSAIARFCENFTEKARAGKLDPVFGRDAEIR
QMVDILARRRKNNPICVGDPGVGKTAVVEGLALRVVEGDVPDSLKDVTILGLDMGLLQAGASVKGEFENR
LKGVITEVKASAKPIILFIDEAHTLIGAGGQAGTSDAANLLKPALARGELRTIAATTWAEYKKYFEKDAA
LARRFQLVKLDEPDLDTAVLILRGLKEKYEDVHKVVLRDDAIVAAAELSSRYIMGRQLPDKAVDLLDTAC
ARVKVLQSAKPDVLENTERRIQALQREKSGLERDADNQQPVDLARLAEIDAELPKLDAQADALRAFWQQQ
RAAARALLDARAARHEAKASGAPEDTLQALSRDIAAAAESFKTAQGDQPLVHIDVDPDVVARVISDWTGI
PAGKMLRDQAQSVMRMADTLKARIRGQDHAMEQIAEVLKTAKSGLKDPDQPMGVFLLAGPSGVGKTETAL
SVADILFGDEKSTTVINMSEFQEKHNVSRLIGSPPGYVGYGEGGVLTEAVRQRPYSVVLLDEVEKAHLDV
MNLFYQVFDKGMLSDGEGKEIDFSNTVIFLTSNLATDVITEMTAGEDKPDAATLLSAVRPILSNHFKPAL
LARMTVIPYFALATDALAGIVRLKLDKIVRRVAHNNKMRFTYTDAVVAQIAARCTEVETGARNIDFILRG
TVLPLMSQEILTRMGEGAALPEVALDVNDSGDFAVTFPGA
 
Nucleotide Sequence: 2643 bp     [Download]
>gi|377807392|ref|NC_016590.1|:213960-216602 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGCTGCTGGTCGAACTGAAGCCCCTCGTGGGCCGCCTCAACGGCTTCTGCAAACAGGCGCTGGAAGACG
GCGTCGGGCTGTGCGTTTCGCGCGGTCATTACGAGATCACCGTCGAGCACATGCTCGTCAAGCTGTTCGG
CGAGCAGCAGGCCGATATCGCGCTGCTGCTGCGTCAGCAAGACGTGGAAGCGGCGCTGGTGCAGCGTTCG
ATCAATCTCTCGCTCGAACAGATGAAGACGGGCAACGCCGGACGTCCCGCGTTCTCGCCGCTCCTGCTCG
AATTGCTGCAGGACGCGTGGCTGATCGCATCGGTGGACATGCAGGAGCCGCGCATCCGTTCGGGCGCGGT
GCTGCTCGCCTTCCTCGCGCGCCCGACCTATTACGCGACGGGCGAGTACGCCGCGCCGCTGCGCGCGCTC
AATCGCGAAACGCTGCTGCGTTCCTTCGACGCGGTGTGCGGCGGCTCCGTCGAAGCCGCCACGCGCGAAG
CCATCGGACAGAACGAAGGCGACGCCTCCGCGCCCGCGAGCGGCGACGGCAGCGCGATCGCGCGGTTCTG
CGAAAACTTCACCGAGAAGGCGCGCGCCGGCAAGCTCGATCCCGTCTTCGGCCGCGATGCCGAAATCCGC
CAGATGGTCGATATCCTCGCGCGCCGCCGCAAGAACAACCCGATCTGCGTCGGCGATCCGGGCGTCGGCA
AGACGGCGGTCGTCGAGGGTCTCGCGCTGCGCGTGGTCGAAGGCGACGTGCCCGATTCGCTCAAGGACGT
GACGATCCTCGGTCTCGACATGGGCCTGCTGCAAGCGGGCGCGAGCGTGAAGGGCGAGTTCGAGAACCGG
CTGAAGGGCGTCATCACCGAGGTCAAGGCATCGGCGAAACCGATCATTCTGTTCATCGACGAAGCGCATA
CGCTGATCGGCGCGGGCGGTCAGGCGGGCACGTCCGACGCGGCCAATCTGTTGAAGCCCGCGCTCGCGCG
CGGCGAGTTGCGCACCATCGCCGCGACGACGTGGGCCGAGTACAAGAAGTACTTCGAAAAAGACGCGGCG
CTCGCGCGGCGCTTCCAGCTCGTCAAGCTCGACGAACCCGATCTCGATACCGCCGTGCTGATCCTGCGCG
GCCTGAAGGAAAAATACGAGGACGTGCACAAGGTCGTGCTGCGCGACGACGCCATCGTCGCGGCGGCGGA
ATTGTCGAGCCGCTACATCATGGGCCGCCAGTTGCCGGACAAGGCCGTCGATCTGCTCGATACCGCCTGC
GCGCGCGTGAAGGTGCTGCAAAGCGCGAAGCCCGATGTGCTCGAAAACACGGAGCGCCGCATTCAGGCGT
TGCAGCGCGAGAAGAGCGGCCTCGAGCGCGATGCGGACAATCAGCAGCCCGTCGATCTCGCGCGTCTCGC
GGAAATCGACGCGGAACTGCCGAAGCTCGACGCGCAAGCCGACGCGCTGCGCGCTTTCTGGCAACAGCAG
CGCGCCGCCGCCCGCGCACTCCTCGATGCACGCGCGGCGCGTCACGAAGCGAAGGCGAGCGGCGCGCCGG
AAGACACGTTGCAGGCGCTCTCGCGGGACATCGCCGCCGCGGCCGAATCGTTCAAGACCGCGCAAGGTGA
CCAACCGCTGGTTCACATCGACGTCGATCCGGACGTGGTCGCGCGCGTGATTTCGGACTGGACCGGCATT
CCCGCCGGCAAGATGCTGCGCGATCAGGCGCAAAGCGTGATGCGCATGGCCGACACGCTCAAGGCGCGCA
TCCGTGGCCAGGACCACGCGATGGAGCAGATCGCCGAAGTGCTCAAGACCGCGAAGTCGGGCCTCAAAGA
CCCCGATCAGCCGATGGGCGTGTTCCTGCTCGCGGGGCCGTCGGGTGTCGGCAAGACGGAGACGGCGCTC
TCGGTGGCGGACATTCTTTTCGGCGATGAAAAATCGACCACCGTCATCAACATGAGCGAGTTCCAGGAGA
AGCACAACGTGAGCCGGCTGATCGGCTCGCCGCCGGGATACGTCGGCTATGGCGAAGGCGGCGTGCTGAC
CGAAGCGGTGCGTCAGCGCCCGTATTCGGTGGTGCTGCTCGATGAAGTCGAAAAGGCGCATCTCGACGTG
ATGAACCTGTTCTATCAGGTCTTCGACAAGGGCATGCTGTCCGACGGCGAAGGCAAGGAAATCGACTTTT
CGAACACGGTGATCTTCCTGACCTCGAATCTCGCGACCGATGTCATCACCGAAATGACCGCAGGCGAAGA
CAAGCCCGACGCCGCCACGCTGCTCTCCGCCGTGCGGCCGATTCTCTCGAATCACTTCAAGCCCGCGCTG
CTCGCGCGCATGACCGTGATTCCGTACTTCGCGCTCGCCACCGACGCGCTCGCGGGCATCGTGCGCCTGA
AGCTCGACAAGATCGTGCGGCGCGTCGCGCACAACAACAAGATGCGCTTCACGTACACCGATGCCGTGGT
CGCGCAGATCGCCGCGCGCTGCACGGAAGTGGAAACGGGCGCACGCAACATCGACTTCATCTTGCGCGGC
ACGGTGCTGCCGCTGATGTCGCAGGAAATTCTCACGCGCATGGGCGAGGGCGCGGCGCTGCCCGAAGTCG
CGCTCGACGTGAACGACAGCGGCGATTTCGCCGTGACGTTCCCCGGCGCGTGA
 Primer design