SecReT6
Protein ID: 377807586
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C001940
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]216685..219315 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG8MJD7
KEGG IDbyi:BYI23_C001940
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.10E-61, Aligned region: 35..336
Phage_base_V [PF04717], Evalue: 2.40E-16, Aligned region: 397..477
Protein Sequence: 876 a.a.     [Download]
>gi|377807586|ref|YP_004978778.1| Rhs element Vgr protein [Burkholderia sp. YI23]
MNSLADRMLANKRFDFTSEAFGADKFAVVEMEGFESISQPFRFVLTLVSDDASIDFDTMLNHRASFTIYG
PEGGIRAPYHGVLAEFEQLHRADGYVFYRAVLVPRLWRLSLFRISEVYLDEQPITETVRGVLETGRLNSA
DYEFKLTGTYRPRTFVCQYQETYLDFVSRWLEKEGIYYYFDHSGGSDKLVVIDDKIMHDAHALPVSYRPD
DALDTGLAADSVRDFVCRQKPLPHEVVLQDYNYRKAAVQLKARATVSDSGIGEVMLYGENFRDQQEGDRY
AKLRAQELICGGKAYSGEGTALGLRSGYFFTLAQHYRDDFNGRYLVTEVHHEGSQAGALLNGVSSPYSDG
ARGGEIVYRNSFRAIPAATQFRPERVTAKPRVAGTMNATIDSEGDGQYAELDEYGQYKVQLPFDKTDKNA
NKSSARLRMATPYAGTDHGMHFPLHKDAEVLLSFIDGDPDQPVIVGSLANSENANIVTQTNAHANEIKTA
GGNHLYLGDSAGKEAIWLHSPFHNSSIGIGSTDPKGGGSLWSSTAGSSESITVGASNKYSVGPNTTVSLG
PGFTASAAVSTSFTMSASTSFAWTSDVSWKKGQSISLHDGDSLSLKEQNKLKGTDSVTISGGQDPAAKLA
FDAAKKKIQYATAFNVAANLATAAAAAGMLGKADDDNGGAGKIGPWISDGYKTMFPMVAGGIVGGAIAHG
LLYAGAKAFAAADAAATYASEIKADTTGINLSVKVASPAPAPVNNVQITPAFVEVNAPTISLNAKSLIDL
TSNDDVVVDAMSVLMTGETSVSVKGETISFASGDSSATVAPTSVQLNSSAVQFNATSVIDLTSNGDLLMD
AVGITMTSANKVEVTAVQVNVDAPTIAISGEVIRLG
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|377807392|ref|NC_016590.1|:216685-219315 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAACTCACTGGCCGACCGCATGCTCGCCAACAAGCGCTTCGATTTCACCTCCGAAGCGTTCGGCGCGG
ACAAGTTCGCGGTCGTCGAGATGGAGGGCTTCGAATCGATCTCGCAGCCGTTCCGCTTCGTCCTCACGCT
GGTGTCGGACGATGCGTCGATCGATTTCGACACGATGCTGAACCATCGCGCGTCGTTCACCATCTACGGC
CCGGAAGGCGGCATCCGCGCGCCGTATCACGGCGTGCTCGCCGAGTTCGAGCAACTGCATCGCGCGGACG
GCTACGTGTTCTATCGCGCCGTGCTGGTGCCGCGTTTGTGGCGTCTGTCGCTCTTTCGCATCTCCGAGGT
CTATCTGGACGAGCAGCCGATCACCGAAACCGTGCGCGGCGTGCTCGAAACCGGCCGCCTGAATTCCGCC
GACTACGAGTTCAAGCTGACCGGCACGTACCGGCCGCGCACGTTCGTCTGCCAGTATCAGGAGACGTATC
TGGACTTCGTGTCGCGCTGGCTGGAGAAGGAAGGCATCTATTACTACTTCGACCACTCGGGCGGCTCGGA
CAAGCTCGTCGTGATCGACGACAAGATCATGCACGACGCGCACGCGCTGCCCGTCTCCTACCGTCCCGAC
GATGCGCTCGACACCGGCCTCGCCGCCGATTCGGTGCGCGATTTCGTGTGCCGTCAAAAGCCGCTGCCGC
ATGAAGTGGTGCTGCAGGACTACAACTATCGCAAGGCGGCGGTGCAGTTGAAGGCGCGCGCGACGGTGTC
CGATTCCGGCATCGGCGAAGTCATGCTCTACGGCGAAAACTTTCGCGATCAGCAGGAAGGCGACCGCTAC
GCGAAGCTGCGCGCGCAGGAACTGATCTGCGGCGGCAAGGCGTATTCGGGCGAAGGCACCGCGCTCGGTC
TGCGCAGCGGCTACTTCTTCACGCTCGCGCAGCACTATCGCGATGACTTCAACGGCCGCTATCTCGTGAC
CGAAGTGCATCACGAAGGCTCGCAGGCGGGCGCGCTCCTGAACGGCGTGTCGAGCCCGTACAGCGACGGC
GCGCGCGGCGGCGAGATCGTCTATCGCAACAGCTTCCGCGCGATTCCCGCCGCGACGCAGTTCCGTCCCG
AGCGCGTGACGGCCAAGCCGCGCGTCGCGGGCACGATGAACGCGACCATCGACAGCGAAGGCGACGGCCA
GTACGCCGAACTTGACGAATACGGCCAGTACAAGGTGCAGTTGCCCTTCGACAAGACCGACAAGAACGCG
AATAAAAGCTCGGCGCGCCTGCGCATGGCGACGCCCTACGCGGGCACGGATCACGGCATGCATTTCCCGC
TGCACAAAGATGCGGAAGTGCTGCTGTCGTTCATCGACGGCGATCCGGACCAGCCGGTGATCGTCGGCAG
CCTGGCGAATTCGGAGAACGCGAACATCGTCACGCAGACCAACGCGCACGCCAACGAGATCAAGACGGCG
GGCGGCAATCACCTGTATCTCGGCGACAGCGCGGGCAAGGAAGCCATCTGGCTGCATTCGCCGTTTCACA
ACAGCTCGATCGGCATCGGCTCGACCGATCCGAAAGGCGGCGGCAGCCTGTGGAGCAGCACGGCGGGCAG
CTCGGAAAGCATCACGGTCGGCGCGAGCAACAAGTATTCGGTGGGACCGAACACGACGGTTTCGCTCGGG
CCGGGGTTCACGGCGAGCGCCGCCGTCAGCACCAGCTTCACGATGTCGGCGAGCACGAGCTTCGCGTGGA
CCTCGGATGTTTCGTGGAAGAAAGGCCAGAGCATTTCGCTCCACGACGGCGATTCGCTCTCGCTCAAGGA
ACAGAACAAGCTGAAGGGCACCGACAGCGTGACGATCAGCGGCGGCCAGGACCCGGCGGCGAAACTCGCC
TTCGACGCCGCCAAGAAGAAGATTCAGTACGCGACCGCATTCAACGTCGCGGCGAATCTGGCGACGGCGG
CGGCCGCGGCCGGCATGCTCGGCAAGGCCGACGACGACAACGGCGGCGCGGGCAAGATCGGCCCGTGGAT
CAGCGACGGCTACAAGACCATGTTCCCGATGGTCGCGGGCGGCATCGTCGGCGGGGCGATCGCGCACGGG
CTGCTCTACGCGGGCGCCAAGGCGTTCGCCGCCGCCGACGCCGCCGCCACGTACGCGAGCGAAATCAAGG
CGGACACCACAGGCATCAACCTCTCGGTGAAGGTGGCCTCGCCCGCGCCCGCACCGGTGAACAACGTGCA
GATCACGCCTGCGTTCGTCGAAGTGAACGCGCCGACGATCTCGCTCAACGCCAAGTCGCTGATCGATCTG
ACCAGCAACGACGATGTGGTCGTCGACGCGATGAGCGTCTTGATGACCGGCGAGACGAGCGTGAGCGTGA
AGGGCGAAACCATCAGCTTCGCGTCGGGCGACAGCAGCGCGACCGTCGCGCCGACGTCCGTGCAGCTCAA
CAGTTCGGCGGTGCAGTTCAACGCGACGAGCGTCATCGATCTGACGAGCAACGGCGATCTGCTGATGGAC
GCCGTCGGCATCACGATGACGTCGGCGAACAAGGTCGAGGTCACGGCCGTTCAGGTGAACGTGGATGCGC
CGACCATCGCCATTTCCGGCGAAGTGATCCGCCTCGGATAA
 Primer design