SecReT6
Protein ID: 377807592
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C002000
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]224954..225781 [+]
Productputative type VI secretion lipoprotein, family
NoteTssJ
UniProt IDG8MJE3
KEGG IDbyi:BYI23_C002000
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.20E-19, Aligned region: 50..186
Protein Sequence: 275 a.a.     [Download]
>gi|377807592|ref|YP_004978784.1| putative type VI secretion lipoprotein, family [Burkholderia sp. YI23]
MSLPRFPDNVRQEQKTRRQPNEAPAMAVAKRIGNPARAAQWRWLACVVSALALSACGSAPPKDPLADVTW
SYANDAVIFEITADAGLNQYDGQSHTLLLGIYETGDAQAFRNLAADPNALAETMATGKVPQTFAQFSRYV
VAPGQHSYLILDRAQNTRSIAMVAGYAQFGVANAARQFDVPVVTKTSGFIFRTHTKSPGPLVVRLNLGAQ
GILNAEVQPGGPDAATLARAQQLDGGGKEIRLSGDAPSNAAGAGATTGVVGAAGSQDTPLRKLAN
 
Nucleotide Sequence: 828 bp     [Download]
>gi|377807392|ref|NC_016590.1|:224954-225781 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAGCCTGCCGCGATTTCCGGACAATGTGCGACAGGAGCAAAAGACTCGACGGCAACCGAATGAGGCAC
CGGCAATGGCTGTAGCGAAACGCATCGGAAATCCTGCACGCGCCGCGCAATGGCGCTGGCTCGCGTGCGT
CGTGAGCGCGCTCGCGCTGTCGGCCTGCGGCAGCGCGCCGCCGAAAGACCCGCTCGCCGATGTGACCTGG
AGCTACGCCAACGACGCCGTGATCTTCGAAATCACCGCCGACGCGGGTCTGAACCAGTACGACGGCCAGT
CGCACACGCTCCTGCTCGGCATCTACGAAACCGGCGACGCGCAAGCGTTCCGCAATCTCGCCGCCGATCC
GAACGCGCTCGCCGAAACGATGGCGACGGGCAAGGTGCCGCAGACCTTCGCGCAGTTTTCGCGCTATGTC
GTCGCGCCCGGCCAGCATTCGTATCTGATCCTCGATCGCGCGCAGAACACGCGTTCGATCGCCATGGTCG
CCGGTTACGCGCAGTTCGGCGTCGCCAACGCGGCCCGCCAGTTCGACGTGCCCGTCGTCACGAAGACGTC
GGGCTTCATCTTCCGCACGCACACGAAATCGCCCGGGCCACTCGTCGTCAGGCTCAATCTCGGCGCGCAA
GGCATTCTCAACGCCGAAGTGCAGCCCGGCGGCCCCGACGCCGCGACGCTCGCGCGCGCGCAGCAACTCG
ACGGCGGCGGCAAGGAAATCCGTCTGAGCGGCGATGCGCCGTCCAATGCGGCCGGCGCCGGCGCCACGAC
CGGCGTCGTGGGCGCGGCCGGTTCCCAAGATACGCCATTGCGCAAGCTCGCCAACTAA
 Primer design