SecReT6
Protein ID: 377807593
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C002010
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]225800..227188 [+]
Producthypothetical protein
NoteTssK
UniProt IDG8MJE4
KEGG IDbyi:BYI23_C002010
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-88, Aligned region: 19..461
Protein Sequence: 462 a.a.     [Download]
>gi|377807593|ref|YP_004978785.1| hypothetical protein BYI23_C002010 [Burkholderia sp. YI23]
MDHNKGIYWYQGMFMQPQHFQLASLHEQFRNKPVVESGLPHFWGAGALDIAAGAIASQTIEVRSAKLIFP
DRTYVEFPGNAVLAPRSFDASSIGDGRALTVYLGVRKFDAAGNNVTLCASADDAAAASTRYATLERPDDV
PDLHSNGPAAPVHTLLHVLKVFFEGETANLGQYDLIPVAQLTRIGDTVTLSERFIAPGYALGGSDTLLRI
VREIRDDVVGRAHQLQEFKNPRELQKAEFDPGYMMLLLAMRTLSRAAPGLVHLTQTPTVHPWQVYGALRG
LVGELSAFSERFDMLGEAADGTPGLPAYDHTDLYNCFSRAQALIGFLLGEIAVGPEHLAVLDYRDGMFAG
DLPRAFFDRRNRFYLVLRTEQAATQVVDGALHDARLANAADVTRLVAHALPGLELIHMANAPQGMPRRAS
SNYFRIEQVSELWDAVERDENIALQWPDAPQDLRAEIVVLRR
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|377807392|ref|NC_016590.1|:225800-227188 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGGACCATAACAAGGGCATCTACTGGTATCAGGGCATGTTCATGCAGCCCCAGCACTTTCAGCTGGCGT
CGCTGCACGAGCAGTTCCGCAACAAGCCGGTCGTGGAGTCGGGCCTGCCGCACTTCTGGGGCGCGGGCGC
GCTCGATATCGCGGCGGGCGCCATCGCCAGCCAGACCATCGAGGTGCGCTCGGCGAAGCTGATCTTTCCG
GATCGCACGTATGTGGAATTTCCCGGCAACGCCGTGCTCGCGCCGCGTTCGTTCGATGCGAGTTCCATCG
GCGACGGCCGCGCGCTCACCGTCTATCTCGGCGTGCGCAAGTTCGACGCCGCCGGCAACAACGTGACGCT
GTGCGCATCGGCCGATGACGCCGCCGCCGCATCGACCCGCTACGCGACGCTCGAACGCCCCGACGACGTG
CCCGACCTGCATTCGAACGGCCCGGCCGCGCCCGTGCACACGCTCTTGCATGTGCTGAAAGTGTTCTTCG
AAGGCGAGACCGCCAATCTCGGCCAGTACGATCTGATTCCGGTCGCGCAGCTCACGCGCATCGGCGACAC
GGTGACGCTCTCGGAACGCTTCATCGCGCCGGGCTACGCGCTCGGCGGCTCCGACACGCTGCTGCGCATC
GTGCGCGAGATTCGCGACGATGTCGTCGGCCGCGCGCATCAGCTTCAGGAATTCAAGAATCCGCGCGAAC
TGCAAAAGGCCGAATTCGATCCCGGCTACATGATGCTGCTGCTCGCCATGCGCACGCTGTCGCGCGCCGC
GCCCGGTCTCGTGCATCTGACGCAGACGCCGACCGTGCATCCGTGGCAGGTGTACGGCGCATTGCGCGGC
CTCGTCGGCGAACTGAGCGCGTTCTCGGAGCGCTTCGACATGCTCGGCGAAGCCGCCGACGGCACGCCCG
GCCTGCCCGCGTACGATCACACCGATCTCTACAACTGCTTTTCGCGCGCGCAGGCGCTGATCGGCTTTCT
GCTCGGCGAAATCGCCGTCGGGCCGGAGCATCTCGCGGTGCTCGACTATCGCGACGGCATGTTCGCGGGC
GATCTGCCGCGCGCGTTCTTCGACCGGCGCAATCGCTTCTATCTCGTGCTGCGCACGGAGCAGGCGGCCA
CGCAGGTCGTGGACGGCGCGCTGCACGACGCGCGCCTGGCCAATGCCGCCGATGTCACGCGGCTCGTCGC
GCATGCGCTGCCCGGCCTCGAACTGATTCACATGGCGAACGCGCCGCAAGGCATGCCGCGCCGCGCGTCG
TCGAACTATTTCCGGATCGAGCAGGTGAGCGAGTTGTGGGACGCCGTCGAGCGCGACGAAAACATCGCGC
TGCAATGGCCGGACGCGCCGCAGGATCTGCGCGCGGAAATCGTCGTGCTGCGGAGATAG
 Primer design